SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002891 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002891
Domain Number 1 Region: 121-233
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-28
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 77-122
Classification Level Classification E-value
Superfamily SH3-domain 7.35e-16
Family SH3-domain 0.00099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002891   Gene: ENSTTRG00000003081   Transcript: ENSTTRT00000003081
Sequence length 257
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_701:37478:86428:1 gene:ENSTTRG00000003081 transcript:ENSTTRT00000003081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLVRRPGVDAGPRRTTANQTRNSEAPGVPAGGHSVGFSAWSLESAAPGXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXPDELYFEEGDIIYITDMSDTNWWKGTSKGRTGLIPSNYVAEQA
ESIDNPLHEAAKRGNLSWLRECLDNRVGVNGLDKAGSTALYWACHGGHKDIVEVLFTQPN
IELNQQNKLGDTALHAAAWKGYADIVQLLLAKGARTDLRNNEKKLALDMATNAACASLLK
KKQGTDAVRTLSNAEDY
Download sequence
Identical sequences ENSTTRP00000002891 ENSTTRP00000002891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]