SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000002944 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000002944
Domain Number 1 Region: 3-17,47-292
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 6.67e-102
Family Inorganic pyrophosphatase 0.000000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000002944   Gene: ENSTTRG00000003141   Transcript: ENSTTRT00000003141
Sequence length 295
Comment pep:known_by_projection scaffold:turTru1:scaffold_115489:65539:134690:-1 gene:ENSTTRG00000003141 transcript:ENSTTRT00000003141 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NVAGHYISPFHDIPLKADSEEDTGAEGVIDLSKVWENGIPTKRARNDEYENLFNMVVEVP
RWTNAKMEIATEEPLNPIKQDVKDGKLRYVANIFPHKGYIWNYGALPQTWEDPHRKDKST
DCCGDNDPIDVCEIGSKVLSRGDVVHVKILGILALIDQGETDWKLIAINVNDPEASKFHD
IEDVKKYKPGYLEATLNWFRFYKIPEGKPENQFAFNGEFKNKAFALEVIKSTHECWKALL
MEKCAGGAINCTNVQVCDSPFHCSQEEARSLVESVSFSLNKGSNEEDQVWHFLGK
Download sequence
Identical sequences ENSTTRP00000002944 ENSTTRP00000002944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]