SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003167 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003167
Domain Number 1 Region: 892-1073
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.6e-40
Family Ypt/Rab-GAP domain of gyp1p 0.0055
Further Details:      
 
Domain Number 2 Region: 1048-1162
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 1.07e-31
Family Ypt/Rab-GAP domain of gyp1p 0.0039
Further Details:      
 
Domain Number 3 Region: 31-185
Classification Level Classification E-value
Superfamily PH domain-like 7.52e-22
Family Phosphotyrosine-binding domain (PTB) 0.008
Further Details:      
 
Domain Number 4 Region: 189-236,356-441
Classification Level Classification E-value
Superfamily PH domain-like 3.9e-20
Family Phosphotyrosine-binding domain (PTB) 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000003167
Domain Number - Region: 437-498
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0575
Family Recombination protein RecR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003167   Gene: ENSTTRG00000003378   Transcript: ENSTTRT00000003378
Sequence length 1299
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1424:230147:349114:-1 gene:ENSTTRG00000003378 transcript:ENSTTRT00000003378 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPPSCFQDEPFPHPLEPEPGATAQPGQGKPGDKRFRLWYVGGSCLDRRTTLPMLPWLMA
EIRRRSQKPEAGGCGAPAPREVFLVLSAPLLRCVPAPGAGAAGGCGPTAAQPNPAVFIFE
HKAQHISRFIHNSHDLTYFAYLIKAQPDDPESQMACHVFRATDPNQVPDVISSIRQLSKA
AMKEDAKPSKDNEDAFYNSQKFEVLYCGKVTVTHKKAPSSLIDDCIEKFSLHERQRLRVQ
GEPRAADAGEDPAVSEALAPASPADVLSEEGDGVNDTHPVFPAAPSQPGPSSSRVCFPER
ILEDSGFDEQQEFRSRCSSVTGVLQRKVQDNSQKTQPRRRHASAPSHVQPSDSEKNRTML
FQVGRFEINLISPDTKSLVLEKFKDXXXXXXGIKHVDHFGFICRELPEPGLSQYICYVFQ
CASESLVDEVMLTLKQAFSTAAALQSAKTQIKLCEACPMHSLHKLCERIEGLYPPRAKLV
IQRHLSSLTDNEQADIFERVQKMKAVNDQEENELVILHLRQLCEAKQRTHVHIGEGPSTI
SNSTIPENATSSGRFKLDILKNKAKRSLTSSLENIFSRGANRMRGRLGSVDSFERSNSVA
SEKDCSPGDSPPGTPPASPLSSAWQTFPEEDSDSPQFRRRAHTFSHPPSSTKRKLNLQDG
KAHGLRSPLLRHSSSEQCSIFSSVRRMHKESNSSSSLPSLHTSFSAPSVTAPSFLKSFYQ
NSGRLSPQYENEIRRDTALESSDGEGRKRTSSTCSNESLNVGGTPVTPRRISWRQRIFLR
VASPMNKSPSAMQQQDGLDTSELLPLSPLAPPMEEEPLLIFVSGDDDPEKAEEGKKSEEL
RSLWRKAIHQQILLLRMEKENQKLEASRDELQSRKIKLDYEEIGVCQKEVLITWDKKLLN
CRTKIRCDMEDIHTSLKEGVPKSRRGEIWQFLALQYRLRHRLPNKQQPPDTSYKELLKQL
TVQQHAILVDLGRTFPTHPYFSAQLGAGQLSLFNLLKAYSLLDKEVGYCQGISFVAGVLL
LHMSEEQAFEMLKFLMYDLGFRKQYRPDMMSLQIQMYQLSRLLHDYHRDLYNHLEENEIS
PSLYAAPWFLTLFASQFPLGFVARVFDIIFLQGTEVIFKVALSLLSNQEALIMECENFEN
IVEFLKSTLPDMNSSEMEKLITQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXIAHAKIQTLESNLENLLTRETKMKSLIRTLEQEKMAYQ
KAVEQIRKLLPADALANCEPLLRDFNCNPNSKAKTGNKP
Download sequence
Identical sequences ENSTTRP00000003167 ENSTTRP00000003167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]