SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000003440 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000003440
Domain Number 1 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.81e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 616-673
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 561-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 421-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.5e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 5 Region: 673-729
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.44e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-21
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 714-766
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.06e-21
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 8 Region: 309-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.18e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 2-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-17
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 10 Region: 252-309
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 11 Region: 468-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000126
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 12 Region: 214-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000464
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000003440   Gene: ENSTTRG00000003670   Transcript: ENSTTRT00000003667
Sequence length 796
Comment pep:novel genescaffold:turTru1:GeneScaffold_1057:126865:132486:1 gene:ENSTTRG00000003670 transcript:ENSTTRT00000003667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVTFKDVAVAFTEEELGLLDSAQRKLYQDVMVENFRNLVSVSFFRDTKNIEREERLWLM
NSATQINLENNQSELRAVQDRGSREELSCRQIWQQIANDLTRCQDSMINSCQFHKQVDSP
CQIGAGLSIQISEDENHILNDKAGDPSNTGNPRFATLRAQDSWRKTSLTKSQNYQNRHQQ
ISMKNKLCQCKEDVDTISWISHHLDAHGVHKGPKSYGYSDYRKDSMRVSTLDQNTMIHTG
QKPYQCNECKETFTDLSTFDLHQQLHSKEKSHMCSECGKGFRYSSVLHIHQRVHMGGKHS
ECDECGKEFSQSSQLQTPQKVHTVEKPFKCGECGKVFSRRSALTIHCKVHTGEKPYNCEE
CGRAFSQASHLQDHQRVHTGEKPFKCDTCDKSFSRNSHLQSHQRVHTGEKPYKCEECGKG
FICSSNLYIHQRVHTGEKPYKCEECGRGFSRPSSLQAHQGVHTGEKSYICNVCGKGFTLS
SNLQARQRVHTGEKPYKCNECGKSFRRNSHYQVHLVVHTGEKPYKCEVCGKGFSQSSYLQ
IHQKAHSVEKPYKCEECGQGFNQSSRLQIHQLIHTGEKPYKCEECGKGFSRRADLKIHCR
IHTGEKPYNCEECGKVFRQASNLLAHQRVHSGEKPFKCEECGKSFGRSSHLQAHQKVHTG
EKPYKCEECGKGFKWSLNLDMHQRVHTGEKPYKCGECGKHFSQASSLQLHQSVHTGEKPY
RCDRCSKVFSRSSQLQSHQRVHTGEKPYKCETCGKSFSWRSNLTIHHRIHAADKSYKSDR
SGKTIREPTHEKISIK
Download sequence
Identical sequences ENSTTRP00000003440 ENSTTRP00000003440

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]