SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004111 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004111
Domain Number 1 Region: 9-70
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-24
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 2 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 468-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.18e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 262-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-20
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 7 Region: 510-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000018
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004111   Gene: ENSTTRG00000004371   Transcript: ENSTTRT00000004367
Sequence length 572
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3363:116606:124760:1 gene:ENSTTRG00000004371 transcript:ENSTTRT00000004367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAELLTARSHTLVTFKDILVNFTREEWKLLDPAQQLMYKDVMLENYRNLVSLGHQLPKP
EVILQLEKGEEPWLLERGIHQETYPDLETAVEVKSSASSKSISKDKHSCDVKMKRMAKSD
LWYLSLEEVWTREGQLDRPQGSQERHLRQVAFTQKKALPQERVCENGKYRGNCLLPAQLV
LREYFHKHDSHPKSLKHDLVFSGHQESYASNSNDSGQTFCQNIHLLQFARTQAGDKSYRC
PDNNSLTHGTSLGISKGTHREKPYECKECGKFFSWRSNLTRHRLIHTGEKPYECKECGKS
FSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYTCNQCGKSFVHS
SRLIRHQRTHTGEKPYECAECGKSFRQSTHLILHQRTHVRVRPYECSDCGKSYSQRSHLV
VHHRTHTGLKPFECKDCGKCFSRSSHLFSHQRTHTGEKPYACHDCGKSFSQSSALIVHQR
IHTGEKPYECCQCGKAFIRKNDLIKHQRVHTGEETYKCNQCGIIFSQNSPRIVYQIAHTG
EQFLTCNQCGTALVNSPNLIRYQTNHIRENAY
Download sequence
Identical sequences ENSTTRP00000004111 ENSTTRP00000004111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]