SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004271 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004271
Domain Number 1 Region: 14-75
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-26
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 2 Region: 339-396
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.6e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 507-564
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 451-508
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.66e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 6 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.52e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 7 Region: 549-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-18
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 8 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.65e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 172-228
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000113
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004271   Gene: ENSTTRG00000004537   Transcript: ENSTTRT00000004534
Sequence length 610
Comment pep:novel scaffold:turTru1:scaffold_89437:57241:64886:1 gene:ENSTTRG00000004537 transcript:ENSTTRT00000004534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEERTAAELQKNMTQEPVVFEDVAVDFTQEEWALLDLAQRNLYRDVMLENFRNLASLGY
PLHTPYLISQWKQEEDLEIAERGPTQGEHQEGFETQLKTNELVAAQDIYGEKISSEQNVV
RFKRSASSLSILHKSWEYHGFDYQNKNHERHLRSHMVENIYEHNEENQCRQTFSHISNLN
ILKRTTEVKAFECQECKKAFTDHLSLKNHIRSHTGSKPYQCKECGKAFHFFACFKKHMKT
PTEEKPYECKECTKAFSCSSFFRAHMKIHTGKTNYECKECGKTFSCSSSLTEHKRIHSGD
KPYECKECGKAFSCSSSLSKHKRIHSGDKPYECKECGKAFSSSSHLIIHIRIHTGEKPYE
CKECGKAFSESSKLTVHVRTHTGEKPYKCKECGKAYNCPSSLSIHMRKHTGEKPYECLEC
GKAFYLPTSLNTHVKNQSREKPYECKECGKAFSCPSSFRAHVRDHTGKVQYECKECGKAF
SRSSSLTEHLRTHTGEKPYECKKCGKAFIYPSALRIHMRTHTGEKPYECKECGKAFRHSS
YLTVHTRMHTGEKPFECLECGKAFSCPSSFRRHVRSHTGEKPYECKECGKAFVCPAYFRR
HLKTHTRGNI
Download sequence
Identical sequences ENSTTRP00000004271 ENSTTRP00000004271

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]