SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004338 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004338
Domain Number 1 Region: 403-555,589-654
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000000000942
Family Voltage-gated potassium channels 0.023
Further Details:      
 
Domain Number 2 Region: 101-287
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000306
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004338   Gene: ENSTTRG00000004569   Transcript: ENSTTRT00000004604
Sequence length 780
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3186:45375:77695:1 gene:ENSTTRG00000004569 transcript:ENSTTRT00000004604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGKYAVHDSCTPNLSSGGESSPSSLTGHNWEMNYQEAAIYLQEGENNDKFFTHPKNAKAL
AAYLFAHNHLFYLMELSAALLLLLLSLCEAPAVPALRLGIYVHATLELFALMVVVFELCM
KLRWLGLHTFIRHRRTMVKTSVLVVQFVEAIVVLVRQTSHVRVTRALRCIFLVDCRYCGG
VRRNLRQIFQSLPPFMDILSLLLFFMIIFAILGFYLFSPNPSDPYFSTLENSIVSLFVLL
TTANFPDVMMPSYSRNPWSCVFFIVYLSIELYFIMNLLLAVVFDTFNDIEKHKFKSLLLH
KRTAIQHAYRLLISQRGPAGISYRQFEGLMRFYKPRMTAGERYLTFKALNQSNSPLLXXX
XXXXXXXXXXXXXXAKRNREHWFDELPRTAFLIFKGINILVKSKAFQYFMYLVVAVNGVW
ILVETFMLKGGNFFSKHVPWSYLVFLTIYGVELFLKVAGLGPVEYLSSGWNLFDFFVTAF
AFLGLLALAFNMEPFYFIVVLRPLQLLRLFKLKKRYRNVLDTMFELLPRMASLGLTLLTF
YYSFAIVGMEFFCGILYPNCCNTSTVADAYRWLNHTVDNRTVVEEGYYYLNNFDNILNSF
VTLFELTVVNNWYIIMEGITSQTSHWSRLYFMTFYIVTMVVMTIIVAFILEAFVFRMNYS
RKNRDSEVDGGITLEKEISKDELIAVLKLYQEAWGAASDIAQLLKILSQMERYEQNTLVF
LGRRSRTKSDLSLKMYQEEIQEWYEEHARKQEQQQRQLSGRVVPTTPQPPGSRQRSQTIT
Download sequence
Identical sequences ENSTTRP00000004338 ENSTTRP00000004338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]