SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004382 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004382
Domain Number 1 Region: 82-343
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.27e-84
Family Transglutaminase core 0.0000000855
Further Details:      
 
Domain Number 2 Region: 540-631
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 9.42e-20
Family Transglutaminase, two C-terminal domains 0.00011
Further Details:      
 
Domain Number 3 Region: 432-534
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 1.54e-18
Family Transglutaminase, two C-terminal domains 0.00059
Further Details:      
 
Domain Number 4 Region: 2-81
Classification Level Classification E-value
Superfamily E set domains 1.36e-16
Family Transglutaminase N-terminal domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004382   Gene: ENSTTRG00000004647   Transcript: ENSTTRT00000004649
Sequence length 635
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2501:29730:66525:1 gene:ENSTTRG00000004647 transcript:ENSTTRT00000004649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQASEALRTKAVFQTSELEESNAWMAVKEAHMENTMTISLTNPPDAVIACYQLSTKVSSR
CKHSNRKLGEFVLLFNPWCPEDDVFLATEEERQEYMLNDSGIIFRGVEKHIAQGWNFRKF
EEDILDICFCILDRSPSHQDDPATTKASHHYDPIYVTGAISAMVNSNNDQGMVQGQWQGK
YGGSTSPLHWRGSVAILHKSFKGRFKPVRYGQCWVFAGVMCTVLGCLGISTRIVSKFNLA
HDTGRNLSVDKYMDSFGWTLEDLMEDSMWNFHVWNESWFVRQDLGPAYNGWQVLDPTPRE
ESESVFQCGPASVTAIRKGDAHLIHDSPSVFAEVNVNYITWXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSQKERMYSKTMKKLLRVEASGRRAQVHSVGSHGLW
HEDLLEPANKPSITGKFKVLEPPVLGHDLRLVLCLANLTSWVQWVQVTIFYTHKPVAEIL
HESHAVKLGPEEEKKIPIAISYSQYKEDLTEDKKMLLAAMYLVTKGEKLLVKDITLEDFI
IIKVLGPAAVGVEVMVVNPLSERVQDCMLMVEGSGLLQGQLSIDVPSLQPQERASVQFNI
IPSKSGPRQLQVDLVSSHFPDIKVFVIIHVATAKL
Download sequence
Identical sequences ENSTTRP00000004382 ENSTTRP00000004382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]