SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000004428 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000004428
Domain Number 1 Region: 583-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000411
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 620-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000133
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 100-130
Classification Level Classification E-value
Superfamily SET domain 0.0000085
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 142-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000809
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000004428   Gene: ENSTTRG00000004705   Transcript: ENSTTRT00000004698
Sequence length 718
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1815:346264:353917:1 gene:ENSTTRG00000004705 transcript:ENSTTRT00000004698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGAARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVLAIPTSAPQVR
MVRGELVDESGGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVW
YSNSLAQWFDIPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSSGGGRAY
LHHEHTARQGAAPAADGLRLSPKPPAPDFAAAAPAGTLRAHPQVPPALQACGARESIKRE
ASSAPSATSPPLAKWGPSKKGKEQPERILDMSGAARGHGHFLGIVGGSPAGGGGLAFYPG
VRSAFKPAGLARAAAAAHCDPYREEGGGKPGASLALSRLLGGGRVGGRPGSGENPAAGEA
GHHHHHHAHHHHHHHPKCLLAGDPPPPPGLPCSGALRGFPLLPGPPEEASAFKHVERAPP
AAAELPGARYAQLPPAAGLPLERCVLPALDAGGLKGYPGGECSHLPAVMPAFTVYNGELL
YGSPAAATYYPLKLHFGGLLKYPESLSYFSGPAAAALSPAELGSLATIDREIAMHTQQLS
EMAAGKGRGRLDAGTLPAAVVAAGGAGGCSSGGGGAGKPKTGHLCLYCGKLYSRKYGLKI
HMRTHTGYKPLKCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVK
SRHPGQNLLAKAADGPGAEPDYPQEPGEPKSDNDSDVDVCFTDDQSDPEAGGGGERDS
Download sequence
Identical sequences ENSTTRP00000004428 ENSTTRP00000004428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]