SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000005564 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000005564
Domain Number 1 Region: 125-304
Classification Level Classification E-value
Superfamily HAD-like 3.97e-26
Family Hypothetical protein VC0232 0.058
Further Details:      
 
Domain Number 2 Region: 4-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.53e-20
Family Ubiquitin-related 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000005564   Gene: ENSTTRG00000005876   Transcript: ENSTTRT00000005885
Sequence length 317
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2371:17540:34475:1 gene:ENSTTRG00000005876 transcript:ENSTTRT00000005885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPIIVKWGGQEYSVTTLSEDDTVLDLKQFLKTLTGVLPERQKLLGLKVKGKPAENDVK
LGALKLKPNTKIMMMGTREESLEDVLGPPPDNDDVINDFDIEDEVVEVENREENLLKISR
RVKEYKVEVLNPPREGKKLLVLDVDYTLFDHRSCAETGVELMRPYLHELTSAYEDYDIVI
WSATNMKWIEAKMKELGVSTNANYKITFMLDSAAMITVHTPRRGLIDVKPLGVIWGKFSE
FYSKKNTIMFDDIGRNFLMNPQNGLKIRPFMKAHLNRDKDKELLKLTQYLKEIAKLDDFL
DLNHKYWERYLSKKQGQ
Download sequence
Identical sequences ENSTTRP00000005564 ENSTTRP00000005564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]