SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006057 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006057
Domain Number 1 Region: 4-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 3e-24
Family Ras-binding domain, RBD 0.0079
Further Details:      
 
Domain Number 2 Region: 876-998
Classification Level Classification E-value
Superfamily Ankyrin repeat 8.39e-24
Family Ankyrin repeat 0.000000844
Further Details:      
 
Domain Number 3 Region: 1004-1066
Classification Level Classification E-value
Superfamily SH3-domain 2.36e-17
Family SH3-domain 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006057   Gene: ENSTTRG00000006402   Transcript: ENSTTRT00000006401
Sequence length 1075
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_515:8915:84214:-1 gene:ENSTTRG00000006402 transcript:ENSTTRT00000006401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPMILTVFLSNNEQILTEVPITPETTCRDVVEFCKEPGEGSCHLAEVWRGNERPIPFDY
MMYEHLQKWGPRREEVKFFLRHEDSPTESSEQGGHQTQEQRTQRNVINVPGEKRTENGIG
NPRVELTLSELQDMAARQQQQIENQQQMLVAKEQRLHFLKQQERRQQQSISENEKLQKLK
ERVEAQENKLKKIRAMRGQVDYSKIMNGNLSAEIERFSAMFQEKKQEVQTAILRVDQLSQ
QLEDLKKGKLNGFQSYNGKLTGPAAVELKRLYQELQIRNQLNQEQNSKLQQQKELLNKRN
MEVAVMDKRINELRERLYGKKIQLSRVNGTSSPQSPLSTPGRVAAVGPYIQVPSTGSYPA
PGDPIKPQSLTIASSAAHGRSKSANDGNWPTLKQNSSSLVKPTQIASVDWKDPNVEGPLK
QGAVSSQPTPLSALGAPEKLGIEIGKVPPPIPGVGKQLPPSYGTYPSPAPAGPGSTNSLE
RRKEGSLPRPSAGLPSRQKPAPLPPAAGPHQPGSSQQIQQRISVPPSPTYPPAGLPAFPA
GDGKPELPLTVAIRPFLADKGSRPQSPRKGPQTVNSSSIYSMYLQQATPPKKYQPAAHST
LNKSVKAVYGKPVLPSGSTSPSPLPFLHGSLATSASHPLPPSESAEKEPEQDSPAAPGDG
AAVESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRGSITEPEGPGGP
NIQKLLYQRFNTLAGGMEGTPFYQPSPSRDFLGSLADVDNGNTAANGNLGEAGPTLPTAP
LPAEPAPTSDANDNRLPSPEPEGPICPLNTHQTAEPAEDDNNNVAAAPPTEPPLPPSLPP
AAPPPAAPTSKRTNLKKPNSERTGHGLRVRFNPLALLLDASLEGEFDLVQRIIYEVEDPS
KPNDEGITPLHNAVCAGHHQIVKFLLDFGVNVNAADSDGWTPLHCAASCNSVHLCKQLVE
SGAAIFASTISDVETAADKCEEAEEGYPQCSQFLHGVQEKLGVMNKGVVYALWAYEAQNS
DELSFHEGDALTILRRKDESETDWWWARFGDREGYVPKTLLGLYPRIKPRQRTLA
Download sequence
Identical sequences ENSTTRP00000006057 ENSTTRP00000006057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]