SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006372 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006372
Domain Number 1 Region: 37-126
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.07e-36
Family SCAN domain 0.0000625
Further Details:      
 
Domain Number 2 Region: 406-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.81e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 741-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 798-854
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-23
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 5 Region: 910-966
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.71e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 6 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.16e-22
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 629-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 854-910
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 462-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 10 Region: 211-269
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 11 Region: 573-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 686-742
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-19
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 13 Region: 365-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.22e-16
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 14 Region: 951-1001
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000419
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006372   Gene: ENSTTRG00000006738   Transcript: ENSTTRT00000006737
Sequence length 1028
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1747:23096:35497:1 gene:ENSTTRG00000006738 transcript:ENSTTRT00000006737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRENWAHSALRQEGLVKGKDDTWKWGTSFQGSSSSVWETSHLHFRQLRYHETSGPQEAL
SRLRELCRRWLRPEARTKAQILELLVLEQFLSILPGEIRTWVQIHRPGSGEEAVALVEEL
QKDLDGPALKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXSPAPEASALSQEENPRNQLMALMLLTAQPQELVMFEEVSVCFTSEEWACLGPIQRA
LYWDVMLENYGNVTSLEWETMTENEEVTSKSSLSQRADSQKGASKRLQGSVPQVLDFEEE
YEWQVLASQWGNETRERDTLKKDSLCEREKKKRTPSEKRGQKWKEFGESLTSDSAFSESL
IGTEGKKLYKCDICCKHFNKISHLINHRRIHTGEKPHKCKECGKGFIQRSSLLMHLRNHS
GEKPYKCNECGKAFSQSAYLLNHQRIHTGEKPYKCKECGKGFYRHSGLIIHLRRHSGERP
YKCNECGKVFSQNAYLIDHQRLHKGEEPYKCNKCQKAFILKKSLILHQRIHSGEKPYKCD
ECGKTFAQTTYLVDHQRLHSTENPYKCKECGKVFIRSKSLLLHQRVHTEKKTFGCKKCGK
IFTSKSSLIDHKRMHSREKPYKCTECGKAFTQSAYLFDHQRLHNGEKPYECNECGKVFIL
KKSLILHQRFHTGENLYECKDCGKVFGSNRNLIDHERLHNGEKPYECRECGKTFIMSKSF
MVHQKLHTQEKAYKCEDCGKAFSYNSSLLVHRRIHTGEKPFECSDCGRAFSSNRNLIEHK
RIHSGEKPYECNECGKCFILKKSLIGHQRIHTREKSYKCNDCGKVFSYRSNLIAHQRIHT
GEKPYACNECGKGFTYNRNLIEHQRIHSGEKTYECHICRKVLTSSRNLMVHQRIHTGEKP
YKCNECGKDFSQNKNLVVHQRMHTGEKPYECEKCRKSFTSKRNLVGHQRIHTGEKPYGCN
DCSKVFRQRKNLTVHQKIHTDEKNCECDESEKEFSQSSNLHLQQKVHSVEEFPWLQNANE
SKTEIQKI
Download sequence
Identical sequences ENSTTRP00000006372 ENSTTRP00000006372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]