SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006482 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006482
Domain Number 1 Region: 4-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-24
Family KRAB domain (Kruppel-associated box) 0.00083
Further Details:      
 
Domain Number 2 Region: 206-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.11e-20
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 3 Region: 248-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.37e-18
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 164-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006482   Gene: ENSTTRG00000006856   Transcript: ENSTTRT00000006856
Sequence length 299
Comment pep:novel scaffold:turTru1:scaffold_87144:32371:36720:-1 gene:ENSTTRG00000006856 transcript:ENSTTRT00000006856 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPLESVTFEDVAINFTQEEWALLDTSQKTLFRNVMLENITHLVSVGYQISKSDVISQLE
QGKELWSEATGCLQGQSPDGESPLRREMIFTQSVYRKHIFATMPMQVSHTQGDPVGWTDL
SDEFTPRSSPQHSPIPLRRKSNVSKQHGKSLSQGSFLDGQDHIHTRAKSFECPLCGKAFS
TGFRLRQHKMIHTEEKQYKCHVCGKVFNQSSLVKRHEKTHTGEKPYECCLCKKTFSQISY
LRKHEKIHPREKPYECHLCGKTFNQRSGLRTHNKIHTGEKPHVCLLCGKAFTQTSDLRR
Download sequence
Identical sequences ENSTTRP00000006482 ENSTTRP00000006482

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]