SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006825 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006825
Domain Number 1 Region: 2-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.71e-27
Family KRAB domain (Kruppel-associated box) 0.00093
Further Details:      
 
Domain Number 2 Region: 283-340
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.67e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 369-424
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 227-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.9e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 162-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-16
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 330-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000232
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006825   Gene: ENSTTRG00000007212   Transcript: ENSTTRT00000007211
Sequence length 478
Comment pep:known_by_projection scaffold:turTru1:scaffold_92694:6661:15529:1 gene:ENSTTRG00000007212 transcript:ENSTTRT00000007211 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMKAQGSLTLKDVAVDFTWEEWQLLDPDQKDLYRDVMLENYSNLVSVGYQVNKPDILSKL
EQGEPPWTLEDEVHSHPHPEIDKVDDHMQPHWQNQSILKMLEQCYEHGKTMKSYLDVINL
STSCKQIESAEFNGDGRSFLHVDHEQTHTEIKHRDIHKIENTHECTECGKAFLKKSRLNE
HKRIHTGKKPHRCSVCGKTFSKKFKLTEHQRTHKGEKPHECSVCAKAFYRKFKLTEHQRT
HTGEKPYECPECGKAFFRKAELVIHQRNKRGEKPHVCNECGKAFSRKSQLILHQKIHTGE
KSYICSECGKGFIQKGNLIIHQRTHTGEKPYVCTECGKAFSQKACLIAHQRFHTGKTPFV
CTDCGKSCSQKSGLIKHQRIHTGEKPYACSDCGKAFTTKTMLIVHQRTHTGERPYGCNEC
GKAFSHMSCLVKHKRTHTREKQLDSVKVEYPSTKGHSLLDTSELMQGENTVNMVTVQM
Download sequence
Identical sequences ENSTTRP00000006825 ENSTTRP00000006825

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]