SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000006963 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000006963
Domain Number 1 Region: 414-671
Classification Level Classification E-value
Superfamily YWTD domain 1.57e-48
Family YWTD domain 0.0000001
Further Details:      
 
Domain Number 2 Region: 327-405,672-722
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000137
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 206-246
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000183
Family LDL receptor-like module 0.0005
Further Details:      
 
Domain Number 4 Region: 4-40
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000288
Family LDL receptor-like module 0.00075
Further Details:      
 
Domain Number 5 Region: 121-160
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000126
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 6 Region: 244-284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000641
Family LDL receptor-like module 0.00054
Further Details:      
 
Domain Number 7 Region: 42-80
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 8 Region: 159-197
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000798
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 9 Region: 79-121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000006963   Gene: ENSTTRG00000007358   Transcript: ENSTTRT00000007358
Sequence length 844
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1866:81616:100934:1 gene:ENSTTRG00000007358 transcript:ENSTTRT00000007358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKAKCEPSQFQCTNGRCITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCNNGQCVPSR
WQCDGDPDCEDGSDESPEQCHMRTCRISEISCGARSTQCIPVSWRCDGENDCDSGEDEEN
CGNVTCSPDEFTCSSGRCISRNFVCNGQDDCSDGSDELDCTPPTCGAHEFQCSTSSCIPI
SWVCDDDADCSDQSDESLEQCGRQPVIHTKCPASEIQCGSGECIHKKWRCDGDPDCKDGS
DEVNCPSRTCQPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCNXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVNECLVNNGGCSHICKDLVIGYECDCAAGFELI
DRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTNRR
DIRKIGLERKEYIQLVEQLRNTVALDADIGAQKLFWADLSQKAIFSASIDDKVGRHVKMI
DNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGTKRKFLFNSDLREPASIAVDPLSGF
VYWSDWGEPAKIEKAGMNGFDRRALVTADIQWPNGITLDLIKGRLYWLDSKLHMLSSVDL
NGQDRRVVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQ
DIIVYHALVQPSGKNWCKEDMENGGCEYLCLPAPQINDHSPKYTCSCPNGYRLEDNGREC
QSTATTVTHSETKDTNTTEMSPTSGLAPGEINVTTAVSEVSVPPKGTSAAWAILPLLLLA
MAAVGGYLMWRNWQHKNMKSMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAISVVSTD
DDLA
Download sequence
Identical sequences ENSTTRP00000006963 ENSTTRP00000006963

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]