SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007193 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007193
Domain Number 1 Region: 434-491
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 55-116
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-24
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 3 Region: 655-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 378-435
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.34e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 5 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.32e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 599-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 491-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.04e-20
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 700-752
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 9 Region: 546-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000686
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 10 Region: 273-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000153
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 11 Region: 214-286
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000964
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 12 Region: 189-236
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000351
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007193   Gene: ENSTTRG00000007606   Transcript: ENSTTRT00000007605
Sequence length 766
Comment pep:novel scaffold:turTru1:scaffold_91649:31451:49134:1 gene:ENSTTRG00000007606 transcript:ENSTTRT00000007605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AQRGLLWPVSRRSDVRSAPEGAAPDRSLGSPGPAASRRGPPFTVYFFQEQQKMNESQGPV
SFTDVAVDFTQEEWQQLDPDEKTTYRDVMLENYSHLVSVGYDSTKPNVILKLEQGEEPWV
ADGEFPRQFHPEEVWKVDDLMERAQENKDECSRQAVSINSRTLTEEREVAFDKTYNMEIS
LVPSNLMSHNCVSCGKTLGSTSELIISDGSYAREKPDECSECGKTFHGEKLYEFHQNGEA
FSQNEESIQKISILEKPFEYNECTEALDNEAVFITHKRAYMGEKPYDWNDSGSDFIQMSS
FNVYQRSQMELKPFECSECGKSFCKKSKFIIHQRAHTGEKPYECNVCGKSFSQKGTLTVH
RRSHLEEKPYKCNECGKTFCQKLHLTQHLRTHSGEKPYECNECGKTFCQKTHLTLHQRNH
SGERPYPCNECGKSFSRKSALSDHQRTHTGEKLYKCNECGKSYYRKSTLITHQRTHTGEK
PYQCSECGKFFSRVSYLTIHYRSHLEEKPYECNECGKTFNLNSAFIRHRKVHTDEKPHEC
SECGKFSYLTNHHTTHLGEKPYECSECGKTLLENSAFDGHQSLPKGEKSYECNICGKLFS
ELSYYTIHYRSHSEEKPYGCNECGKTFSHNSSLFRHQRVHTGEKPYECYECGKFFSQKSY
LTIHHRIHSGEKPYECSKCGKVFSRMSNLTVHYRSHSGEKPYECNECGKVFSQKSYLTVH
YRTHSGEKPYECNECGKKFHHRSAFNSHQRIHRRGNMNVLDMGMLL
Download sequence
Identical sequences ENSTTRP00000007193 ENSTTRP00000007193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]