SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007253 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007253
Domain Number 1 Region: 766-947
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.09e-44
Family Ypt/Rab-GAP domain of gyp1p 0.0042
Further Details:      
 
Domain Number 2 Region: 922-1043
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 8.63e-32
Family Ypt/Rab-GAP domain of gyp1p 0.0045
Further Details:      
 
Domain Number 3 Region: 160-191,226-352
Classification Level Classification E-value
Superfamily PH domain-like 5.41e-24
Family Phosphotyrosine-binding domain (PTB) 0.0093
Further Details:      
 
Domain Number 4 Region: 14-155
Classification Level Classification E-value
Superfamily PH domain-like 4.78e-20
Family Phosphotyrosine-binding domain (PTB) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007253   Gene: ENSTTRG00000007662   Transcript: ENSTTRT00000007668
Sequence length 1161
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2579:83882:207763:1 gene:ENSTTRG00000007662 transcript:ENSTTRT00000007668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPITFTARKHPFPSEVSVEFSLQLVGFLPVHSLTTMPMLPWVVAEVRRLSGQSSTKESG
TKQVHLCVSPSGLRCEPEPGRSQQWDPLISSIFECKPQRVHRLIHNSHDPSYFACLIKDD
AASQQSICYVFKADGQTKVPEIISSIRQAGKIARQDELRCPSEFDDTFAKKFEVLFCGRV
AVAHRKAPPALIDECIEGFSHVSGGGFSSDQLRAAPAGGPGAGPRPMRKSFSQPGLRSLA
FRKEFQDAGLRSSSFFSSFEENDIENHLISGHNIVQPTDIEENRTMLFTIGQSEVYLISP
DTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALXXXXXX
XXXXXXXVAAVQQTAKATAQLCEGCPLQGLHKLCERIEGMNSSKTKLELQKHLTTLTNQE
QATIFEEVQKLRPRNEQRENELIVSFLRCLYEEKQKVHVHIGEIKQASQIAAENTGSELP
SSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSASLDLDSSVSSTLSNTSKEP
SVCEKEAFPISESSFRLLGSSDDLSSDSESHAAEEPALLSPQQGFRRRANTLSHIPVECQ
QPLQQAQGSPGVSQRKLVRYHSVSTETPHERKDFESKASHLGDASGTPVKTRRHSWRQQI
FLRVATPQKACDSPGRHEDYSELGELPPRSPLEPVCEDGPFGPVPEEKKRTSRELRELWQ
KAILQQILLLRMEKENQKLQASENDLLNRLKLDYEEITPCLEVTTVWEKMLTTPGRSKIK
FDMEKMHSAVGQGVPRHHRGEIWKFLAEQYHLKHPFPSKQQPKDTPYKELLKQLTSHQHA
ILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGILLLHMGEE
EAFNMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEIGPSLYAA
PWFLTVFASQFPLGFVARVFDMIFLQGSEVIFKVALSLLGSHKPLILQHENLETIVDFIK
STLPNLGLVQMEKTISQVFVMDISKQLQAYEVEYHVLQEELIDPSPLSDNQRMDRLEKTN
SSLRKQNLDLLEQLQVANGRIQSLEATIEKLLTSESKLKQATLALELERSALLQTVERLQ
GQTAELGGPEPDPVPPEPAGH
Download sequence
Identical sequences ENSTTRP00000007253 ENSTTRP00000007253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]