SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000007677 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000007677
Domain Number 1 Region: 335-392
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.15e-24
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 447-504
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.04e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 504-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-21
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 4 Region: 392-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 8-66
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-16
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 6 Region: 550-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000144
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 281-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000991
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 8 Region: 231-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000021
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000007677
Domain Number - Region: 85-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000136
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number - Region: 209-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00152
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000007677   Gene: ENSTTRG00000008110   Transcript: ENSTTRT00000008113
Sequence length 605
Comment pep:novel scaffold:turTru1:scaffold_86142:62225:78007:-1 gene:ENSTTRG00000008110 transcript:ENSTTRT00000008113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAALRDPPQGGVTFPDVAVRFSWGEWKLLDEAQRRLYLSVTLDIYALISSLGCCCGAEG
EETSCEETVPVGVSQAGSPKAAPSSQKTHPCEMCGPVLRDIFQLAEHQGTQHSHKLLRCG
ACQQHFICLEHCTQGFFFRSHRFQVSQKPLTSRKIRASVGHLQQQTTHTVEKPSKITQCG
STSQDKKNHHTKKYKKTLSPKHTLVQDYIYTERQCFVCSECGKTFSTNRICYHLRVHTRE
RLHVFSRSDKSFRQSSTISQHRKIYTGSGQDKCSKCGKSLTQKCVLIYPQRLHSGENSSV
CSDCAKSFSHSSVFIRHKRVFSGERFYKCSDCVKSFTCRSALIYHQRSHTGERPYECSEC
GKSFTTNRTLRSHQRSHTGEKPYKCTECGKSYTSTNAFRYHQRVHSGERPYECSECGKSF
MSRSAFISHHRYHTGERPYECSECEKSFVSRAALRYHQRSHTGEKPYECTECGKSFTTNS
NFHYHLRVHTGERPYECSECGKCFTSSSNLHYHQSTHTGERPYECSECGKTFITPAILRY
HQKIHSSEWPFTCSECGKSFTSKSNFCYHLGVHSGERPCVRCSECGKSFTSSSTLRYHQR
IHSGE
Download sequence
Identical sequences ENSTTRP00000007677 ENSTTRP00000007677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]