SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008387 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008387
Domain Number 1 Region: 294-348
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 2 Region: 119-212
Classification Level Classification E-value
Superfamily PX domain 0.000000275
Family PX domain 0.0039
Further Details:      
 
Domain Number 3 Region: 890-920
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000384
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008387   Gene: ENSTTRG00000008840   Transcript: ENSTTRT00000008845
Sequence length 944
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1257:96846:151332:-1 gene:ENSTTRG00000008840 transcript:ENSTTRT00000008845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGGGGGGGGPGGKSALPTCPACHKVTPRTETP
VSSVGNSLENALHTSAHSTEESLPKRPGGKHSRXXXXXXXXXXXXXXXXXXXXXXXXXVL
WSDSSVTSVTKSSSEVTEFSKLSQLCPEENLEKFIPCLAGPDAFYVERNHMDLEGLRYLA
SLPSHILKNDHVKKFFSTSSPTQQLQSPGPGNPSLSKVGTMMGVSGRPVCGVAGIPSSQG
GAQHHVQHSASTSALPHCSHAGGAGSALAYRTPMDSSPAILMPSSLQAPQTQEQNGILDW
LRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCLN
PSAPPPVSSSGVARVPPTSHVGPVQPVRSSHAAALRVEVAQPPHQTAREGSSSECSSSSP
SPMGVQAREESSDSAEENDRRVEIHLEGSDKEKPVMLLNHFTSSSARPTAQVLPVQNEAG
SNPSGHHPLPPQMMTAASHIAPIRMLNSVHKAERGGADMKLLSSSVHSLLSLEERSKVSG
PRSGIKVDKNFGSTMMDMLPASTPHQPMQVLSGLTESSSVSPTVSFGPRTKVVHASALDR
VMKPAQQPALVVETSTAAAGTSSTVFHVARPPIKLLVSSSVPADSAVSGQTSCSGNVQIS
VPPAIINPRTALYTANTKAAFSAMSSVPVGPLQGSFCANSNTASAGSHPATSFANMATVP
SCPAPSSSPALSSVPESSFYSSSGGGGXXXXXXXXXXXXXHHHHHQQQPAPQQPAPAPPP
GCVVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSVFPFPFLPFSPMCGSGYVGAQQYGG
GAFPVVHSPYSSGVGPEPVLGGQSAFTVPPVQNFMGAAGVYQAQGLVGSSNGSSHKKSGN
LSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences ENSTTRP00000008387 ENSTTRP00000008387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]