SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008542 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008542
Domain Number 1 Region: 191-247
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 153-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000757
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 361-411
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000294
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 332-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000294
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008542
Domain Number - Region: 247-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000104
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 11-36
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0275
Family KRAB domain (Kruppel-associated box) 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008542   Gene: ENSTTRG00000009008   Transcript: ENSTTRT00000009006
Sequence length 415
Comment pep:known_by_projection scaffold:turTru1:scaffold_116120:24319:29063:1 gene:ENSTTRG00000009008 transcript:ENSTTRT00000009006 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTLSTSGAQPVLFEDLAVYFSEECVSQHPAQRSRSRXXXXXXXXXXXXXXGEGKIEIN
QKLRLESMGLEELALEKYSIAVPLVYYPEKSSEHGVGNLERKMSGRTPACKKSFISLLVT
IENHTPLIELSQCLGTRALSEILEFPGEEAKNSYKCPECDQSFSDSSYPVLHQKTHSGEK
KYKCGDWEKIFNHRANLRTHQRIHTGEKPFKCAECGGSFRQHSHLSRHMNIHVKEKPYTC
GICGRGFLWLPGLAQHQKTHTAKKACGKYFGQKTNLALPEKRHGSASRHPCSLSRKCFGQ
PSHLALPEWGHEDNPEHCSDCGENLLSFSKFEPLKRPECSLTFLRISELISHQSIHRGEK
PHKCKPCAECFILDSKLACHQKNHTGEPFKCTMCGKSFRLKTHLIVHQQIHAQNT
Download sequence
Identical sequences ENSTTRP00000008542 ENSTTRP00000008542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]