SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008595 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008595
Domain Number 1 Region: 332-465,765-940
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.48e-52
Family Diacylglycerol kinase-like 0.013
Further Details:      
 
Domain Number 2 Region: 64-187
Classification Level Classification E-value
Superfamily PH domain-like 4.11e-29
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 
Domain Number 3 Region: 1145-1210
Classification Level Classification E-value
Superfamily SAM/Pointed domain 7.57e-19
Family SAM (sterile alpha motif) domain 0.0037
Further Details:      
 
Domain Number 4 Region: 233-302
Classification Level Classification E-value
Superfamily Cysteine-rich domain 6.73e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.000051
Further Details:      
 
Domain Number 5 Region: 173-229
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000389
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008595   Gene: ENSTTRG00000009046   Transcript: ENSTTRT00000009064
Sequence length 1218
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_581:25191:189013:1 gene:ENSTTRG00000009046 transcript:ENSTTRT00000009064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGAGGQHHPSGAAGGAAAAAGAAVAPATASAGPGEDSSDSEAEQEGPQKLIRKVSTSGQ
IRTKTSIKEGQLLKQTSSFQRWKKRYFKLRGRTLYYAKDSKSLIFDEVDLSDASVSEAST
KNANNSFTIITPFRRLMLCAENRKEMEDWISSLKSVQTRETYEVAQFNVEHFSGMHNWYA
CSHARPTFCNVCRESLSGVTSHGLSCEVCKFKAHKRCAVRATNNCKWTTLASIGKDIIEN
EDGLAMPHQWLEGNLPVSAKCAVCEKTCGSVLRLQDWRCLWCKTMVHTACKDLYHPICPL
GQCRVSVIPPIALNSTDSDGFCRATFSFCVSPLLVFVNSKSGDNQGVKFLRRFKQLLNPA
QVFDLMNGGPHLGLRLFQKFDNFRILVCGGDGSVGWVLSEIDKLNLNKQCQLGVLPLGTG
NDLARVLGWGGSYDDDTQLPQILEKLERASTKMLDRWSIMTYELKLPAKASLLPEPPEAS
EEFYMTIYEDSVAAHLTKILNSDEHAVVISSAKVLCETVKDFVAKVEKAHEKTLERAVAA
DAVANKCSVLNEKLEQLLQALHTDSQASPVLPGISPLIVEEDPVESSSEESLCESKEQLL
DDTTKPSSQKTVKPREIMLRANSLKKAVRQVIEEAGKVMDDQTVHSSEPVNQSFDYDSTE
TDESKDESKEDDAKASLTVKTAPRSPDGRASRSQTDSGSGPAVAASKENLPVLNTRIICP
GLRAGLAASIAGSSIINKMLLANIDPFGATPFIDPDPDSVDGYSEKCVMNNYFGIGLDAK
ISLEFNNKREEHPEKCRSRTKNLMWYGVLGTRELLQRSYKNLEQRVQLECDGQYIPLPSL
QGIAVLNIPSYAGGTNFWGGTKEDDIFAAPSFDDKILEVVAIFDSVQMAVSRVIKLQHHR
IAQCRTVKITIFGEEGVPVQVDGEAWVQPPGIIKIVHKNRAQMLTRDRAFESTLKSWEDK
QKCDSGKPVLRTHLYIQHAVDLATEEVSQMQLCSQAAEELITXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXSLTRDTATEIAINVKALYNETESLLVGRVPLQLESPHEERVS
NALHSVEVELQKLTEIPWLYYILHPNEDEEPPMDCTKRNSRSTVFRIVPKFKKEKVQKQK
TSSQAVQKWGTEEVAAWLDLLNLGEYKEIFIRHDIRGAELLHLERRDLKDLGIPKVGHMK
RILQGIKELGRSTPQSEV
Download sequence
Identical sequences ENSTTRP00000008595 ENSTTRP00000008595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]