SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000008639 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000008639
Domain Number 1 Region: 221-278
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-22
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 277-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-22
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 1-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-20
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 4 Region: 183-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-19
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 388-439
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000355
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 6 Region: 321-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000184
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000008639
Domain Number - Region: 118-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0207
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000008639   Gene: ENSTTRG00000009112   Transcript: ENSTTRT00000009111
Sequence length 513
Comment pep:novel genescaffold:turTru1:GeneScaffold_1282:38111:46882:1 gene:ENSTTRG00000009112 transcript:ENSTTRT00000009111 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPVTFEDVAVYFSQEEWKLLDEAQRLLYHDVLLETFVLVASLGCWHGAEHKEITSEQNVS
IEVPQINTSKTDLSIRKSYPWERCCLALDSSLCVAEDLGTIPGQKLCVSGVKFHQHSGGK
LFRRDWVRPLRSHIVHASKNSFTCQEAGKDFPGSSSLLQPQVTPKRKPCRGTMDRESLQT
GKRPYECSECGKTFSFKGILVKHQRIHTRERPYECCECGKAFSWKSSLVQHQRLHVGELL
YKCCECGKAFISKVNLCRHQRVHTGERPYECSECGKTFIYKDSLVRHWRVHTGERPYECS
ECGKAFSRKDSLVKHQRVHSGKPYKCSECGKTFFKKIFTLVWHQIHIGERPYEHSEGKFF
SQISNLIVHQRIHTGTKTSEGSECGKFSNCLVLHKRVYTGERPYKCIEYGKHFSQYSTVI
KHQHTGEKPYECTVCGGFFSQNSQLTQHKAHATERHRRYSKWKIFLSESALTEHQKLNSP
EDPVSTVNVRKLSTEGLTSFITRKFLLEKVNHI
Download sequence
Identical sequences ENSTTRP00000008639 ENSTTRP00000008639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]