SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009338 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009338
Domain Number 1 Region: 420-708
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.1e-81
Family Protein kinases, catalytic subunit 0.000000000225
Further Details:      
 
Domain Number 2 Region: 918-1056
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 7.59e-59
Family FAT domain of focal adhesion kinase 0.000000199
Further Details:      
 
Domain Number 3 Region: 42-141
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.68e-40
Family First domain of FERM 0.00000245
Further Details:      
 
Domain Number 4 Region: 143-264
Classification Level Classification E-value
Superfamily Second domain of FERM 4.71e-39
Family Second domain of FERM 0.000000427
Further Details:      
 
Domain Number 5 Region: 265-373
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-36
Family Third domain of FERM 0.00000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009338   Gene: ENSTTRG00000009800   Transcript: ENSTTRT00000009848
Sequence length 1062
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2586:21614:193311:-1 gene:ENSTTRG00000009800 transcript:ENSTTRT00000009848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EYDRYLASSQIMAAAYLDPNLNHTPNSSTKTHLGTGVERSPGAMERVLKVFHYFESNSEP
TTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHLDMGVSNVRE
KYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQDIAL
KLGCLEIRRSYSEMRGNALEKKSNYEVLEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFR
QFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCN
PTHLADFNQVQTIQYSNSEDKDRKGTLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCR
LVHGATQSFIIRPQKEGERALPSIPKLANSEKQGVRTHAVSVSETDDYAEIIDEEDTYTM
PSTRDYEIQRERIELGRCIGEGQFGDVHQGAYTSPENPALAVAIKTCKNCTSDSVREKFL
QEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQ
LSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKAFQXXXXXXWM
APESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPP
TLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEMQQEERMRMESRMQVTVSWDSGGSDE
APLKPSRPGYPSPRSSEGFHPSPQHMVQTNHYQVSGYPGSHGITAVAGSIYPGQASLLDQ
TDSWNHRPQEISMWQPNVEDSATLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEE
RFLKPDVRLSRGSIDREDGGPQGPXXXXXXXXXXXXXXPAAPPKKPPRPGAPGHLSSLAS
LGSPGDNYNEGVKLQPQEISPPPTANLDRSNDRVYENVTGLVRAVIEMSSKIQPAPPEEY
VPMVKEVGLALRTLLATVDETIPVLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMT
SLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLKALGQTRPH
Download sequence
Identical sequences ENSTTRP00000009338 ENSTTRP00000009338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]