SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009401 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009401
Domain Number 1 Region: 196-577
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 9.98e-100
Family Phosphonoacetate hydrolase 0.021
Further Details:      
 
Domain Number 2 Region: 668-912
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 3.47e-25
Family DNA/RNA non-specific endonuclease 0.01
Further Details:      
 
Domain Number 3 Region: 105-150
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000103
Family Somatomedin B domain 0.0021
Further Details:      
 
Domain Number 4 Region: 151-191
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000732
Family Somatomedin B domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009401   Gene: ENSTTRG00000009907   Transcript: ENSTTRT00000009912
Sequence length 925
Comment pep:known_by_projection scaffold:turTru1:scaffold_87845:24262:89330:1 gene:ENSTTRG00000009907 transcript:ENSTTRT00000009912 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERDGCVGVGNRGGEGGRGSREGPAGNGRHLGRGSTAEAPGEPLAASSLLAPMDLGEEPL
EKAARARTAKDPNTYKVLSLVLSVCVLTTILGCIFGLKPSCAKEVKSCKGRCFERTFGNC
RCDVACVDLGNCCLDYQETCIEPERIWTCSKFRCGEKRLSRSLCSCSDDCKDKGDCCINH
GSVCRGEKSWAEETCESINGPQCPAGFEMPPTLLFSLDGFRAEYLHTWGGLLPVISKLKT
CGTYAKNLRPVYPTKTFPNHYSIVTGLYPESHGLIDNKMYDPQRNAYFALKSKEKFNPEW
YKGEPIWLTAKYQGLKTGTFFWPGSDVKINGIFPDIYKVYNGSVPFEERILAVLKWLQLP
KDERPHFYTLYLEEPDSSGHSYGPVSSEVIRALQRVDNMVGMLMDGLKELNLHRCLNLIL
ISDHGMEQGSCKKYVYLSKYLGDIKNVKVIYGPAARLRPSDVPDKYYSFNYEGIAKNLSC
QEPNQHFKPYLKHFLPKRLHFAKSDRIEPLTFYLDPQWQLALNTSERKYCGGGFHGSDNA
FSNMQALFIGYGPGFKHGIEVDSFENIEVYNLMCDLLNLTPAPNNGTHGSLNHLLKNPVY
TPKHPKEFRSLVQCPFTGAPRESLDCSCDPSILPIVDFQTQLNLTMAEEKAIKRGTLPYG
RPRVLWKNSTVCLLYQHQFVSGYSHDILMPLWTAYTVDRNASFSTEDFSNCLYQDLRIPL
RPVHKCSFYKNNTKLSYGFLSPPQLNKGSSQVYSEALLTTNTVPMYQSFQVTWHYFHGTL
LQRYAEERNGLNVVSGPVFDFDYDGHYDSLETLKQNSRIIRNQEILIPTHFFIVLTSCKD
TSQTPSQCENLDTLAFILPHRTDNSESCAHGKHESSWVEELLRRHRARITDVEHITGLSF
YQERKEPISDILKLKTHLPTFNQEG
Download sequence
Identical sequences ENSTTRP00000009401 ENSTTRP00000009401 XP_004313379.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]