SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009405 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009405
Domain Number 1 Region: 25-260
Classification Level Classification E-value
Superfamily L domain-like 3.83e-44
Family Ngr ectodomain-like 0.00064
Further Details:      
 
Domain Number 2 Region: 259-365
Classification Level Classification E-value
Superfamily Immunoglobulin 3.46e-17
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009405   Gene: ENSTTRG00000009916   Transcript: ENSTTRT00000009916
Sequence length 515
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2527:36894:39437:-1 gene:ENSTTRG00000009916 transcript:ENSTTRT00000009916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPGAPALLLLSLLSLPGLPPRAAACPAACRCYSATVECGALRLRLVPSGIPPGTQTLFL
QDNSIARLEPGTLAPLASLRRLYLHNNSLRALEPGAFRAQSRLLELALTGNQLRGLRVGA
FAGLAQLRVLYLAGNQLVQLLDFTFLHLQRLQELHLQENSIELLEDQALAGLSSLALLDL
SRNQLGTISQEALQPLASLQVLRLTENPWRCDCALHWLGTWIKEGGQRLLSSRDKKITCA
EPPRLALQSLLEVSGSSLICIPPSVHVEPLEVTANLGEDLRIACQASGYPQPLVTWRKVA
QPREGPPQAQAQPGGGVPGPGGPGASDTGSGMLFLTNITLAHAGKYECEASNAGGAARLP
FQLLVNLSQQLLLAPAPPRAGDPVSHEHLPEVGGMAFRALGLATQTAIATAIALLALTAL
LLATMICRRRRRRKKAPGPPGEGALFVNDYSDGPCTFAQLEELRDERGHEMFVIDRSKPL
FAEGPAEAAEGAAPGVAQGLPLQPPAAYEIRCGGA
Download sequence
Identical sequences ENSTTRP00000009405 ENSTTRP00000009405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]