SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009444 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009444
Domain Number 1 Region: 25-124
Classification Level Classification E-value
Superfamily SH2 domain 1.06e-26
Family SH2 domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1201-1260
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000000000471
Family SAM (sterile alpha motif) domain 0.0092
Further Details:      
 
Domain Number 3 Region: 412-543
Classification Level Classification E-value
Superfamily DNase I-like 0.00000000000317
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009444   Gene: ENSTTRG00000009944   Transcript: ENSTTRT00000009957
Sequence length 1262
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2438:14234:29671:1 gene:ENSTTRG00000009944 transcript:ENSTTRT00000009957 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASACGAPGPGGAGPGAALGSPAPAWYHRDLSRAAAEELLARAGRDGSFLVRDSESVAGA
FALCVLYQKHVHTYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLYAQPNQGLVCALLL
PVEREREPDLPDDRDASDGEDEKPPLPPRSGSTSISAPLGPSSPLPAPETPTTPAAESAP
NGLSTVSHEYLKGSYGLDLEAVRGGASNLPHLTRTLATSCRRLHSEVDKVLSGLEILSKV
FDQQSSPMVTRLLQQQNPPQTGEQELESLVLKLSVLKDFLSGIQKKALKALQDMSSTAPP
TPLQPSTRKAKTIPVQAFEVKLDVTLGDLTKIGKSQKFTLSVDVEGGRLVLLRRQRDSQE
DWTTFTHDRIRQLIKSQRVQNKLGVVFEKEKDRTQRKDFIFVSARKREAFCQLLQLMKNK
HSKQDEPDMISVFIGTWNMGSVPPPKNVTSWFTSKGLGKTLDEVTVTIPHDIYVFGTQEN
SVGDREWLDLLRGSLKELTDLDYRPIAMQSLWNIKVAVLVKPEHENRISHVSTSSVKTGI
ANTLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXPPVFGTFEVGVTSQFIKKGLSKTSDQAYIEFESIEAIVKTASRTKFFIEFYSTCLE
EYKKSFENDAQSSDNINFLKVQWSSRQLPTLKPILADIEYLQDQHLLLTVKSMDGYESYG
ECVVALKSMIGSTAQQFLTFLSHRGEETGNIRGSMKVRVPTERLGTRERLYEWISDKDEA
GAKSKAPSVSRGSQEPRSGSRKPASGEASCPLSKLFEEPEKPPPTGRPPAPPRAAPREEP
LTPRLKPEGAPELEGVVAPSPKNSFNNPAYYVLEGVPHQLLPPEPPSPARAPVPPATKNK
VAITVPAPQLGRHRPPRVGEGSSSDEESGGTLPPPDFPPPPLPDSAIFLPPSLDPLPGPV
IRGRSAGEARGPPPPKAHPRPPLPPGPSPTSTFLGEAASGDDRSCSVLQMAKTLSEVDYD
PAGPGRSVLLPGPXXXXXXXXXXXXXXXXXXXXXXRIRESIQEDLAEEAPCPQVGRSGGL
GEAGMGAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQL
SK
Download sequence
Identical sequences ENSTTRP00000009444 ENSTTRP00000009444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]