SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000009920 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000009920
Domain Number 1 Region: 574-665
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.19e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 443-614
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000009920   Gene: ENSTTRG00000010462   Transcript: ENSTTRT00000010458
Sequence length 758
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_345:101362:272640:1 gene:ENSTTRG00000010462 transcript:ENSTTRT00000010458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QQQQIQDKPCPPFALLPHPHHPPHLAHQQQGSGGSSPCLRCNSCASSGAPGAGAGDNLSL
LLRTSSPGGAFRTRTSSPLSGSSCCCCCSSRRGSQLNVSELTPSSHASALRQQYAQQPAS
ASQYHQCHSLQPAASPTGSLGSLGSGPPLSHHHHHHHHPHPAHHQHSQPQARRESNPFTE
IAMSSCRYNGGVMRPLSNLSASRRNLHEMDSEAQPLQPPASVGGGGGASSPSAAAAAAAS
SSAPEIVVSKPEHNNSNNLALYGAGGGGSAGGGGGGGSGHGSSGGTKSSKKKNQNIGYKL
GHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAYDKASLYSLALKCLISLSTIIL
LGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLEILVCAIHPIPGNYTFTWTARL
AFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLFTDASSRSIGALNKINFNTRFV
MKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQDVTSNFLGAMWLISITFLSIGY
GDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELTKAEKHVHNFMMDTQLTKRVKN
AAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVD
LAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGSIHALPGLISQTMRQQQRDFLE
AQMENYDKHVPYDAERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences ENSTTRP00000009920 ENSTTRP00000009920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]