SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010014 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010014
Domain Number 1 Region: 173-229
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.2e-16
Family Voltage-gated potassium channels 0.0034
Further Details:      
 
Domain Number 2 Region: 2-131
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000000451
Family Voltage-gated potassium channels 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010014   Gene: ENSTTRG00000010564   Transcript: ENSTTRT00000010560
Sequence length 589
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3001:118127:140980:1 gene:ENSTTRG00000010564 transcript:ENSTTRT00000010560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLVFSCLVLSVLSTIPEHQEIANECLLILEFVMIVVFGLEYIIRIWSAGCCCRYRGWQG
RFRFARKPFCVIDFIVFVASVAVIAAGTQGNIFATSALRSMRFLQILRMVRMDRRGGTWK
LLGSVVLAHSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTLTTIGY
GDKTPHTWLGRVLAAGFALLGVSFFALPAGILGSGFALKVQEQHRQKHFEKRRMPAANLI
QAAWRLYSTDTSRAYLTATWYYYDSILPSFKELALLFEHVQRARNGGLRPLEVRRAPVPD
GAPSRYPPVATCHRPGSTYFCPGESRRMGIKDRIRMGSSQRRTGPSKQHLAPPPMPTSPS
SEQEGEASSPTKVQKSWSFNDRTRFRASLRLKPRASAEEGPSEEVAEEKSYQCELTVDDV
MPAVKTVIRSVRILKFLVAKRKFKETLRPYDVKDVIEQYSAGHLDMLGRIKSLQGRVDQI
VGRGPGDRKSREKGDKGPSDTEAVDEISMMGRVVKVEKQVQSIEHKLDLLLGFYSRCLRS
GTSASLGTVQVPLFDPDITSDYQSPVDHEDISVSAQTLSTSRSVSTNMD
Download sequence
Identical sequences ENSTTRP00000010014 ENSTTRP00000010014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]