SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010104 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010104
Domain Number 1 Region: 215-392
Classification Level Classification E-value
Superfamily MIR domain 5.36e-46
Family MIR domain 0.0025
Further Details:      
 
Domain Number 2 Region: 660-809
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000206
Family SPRY domain 0.091
Further Details:      
 
Domain Number 3 Region: 101-185
Classification Level Classification E-value
Superfamily MIR domain 0.00000589
Family MIR domain 0.021
Further Details:      
 
Domain Number 4 Region: 4041-4119
Classification Level Classification E-value
Superfamily EF-hand 0.0000106
Family Calmodulin-like 0.042
Further Details:      
 
Domain Number 5 Region: 2185-2255
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000017
Family IP3 receptor type 1 binding core, domain 2 0.018
Further Details:      
 
Domain Number 6 Region: 443-550
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000275
Family IP3 receptor type 1 binding core, domain 2 0.012
Further Details:      
 
Domain Number 7 Region: 1426-1550
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000633
Family SPRY domain 0.033
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010104
Domain Number - Region: 1078-1125
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00142
Family SPRY domain 0.039
Further Details:      
 
Domain Number - Region: 4497-4511,4683-4704
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0262
Family Formin homology 2 domain (FH2 domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010104   Gene: ENSTTRG00000010633   Transcript: ENSTTRT00000010657
Sequence length 5021
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_473:83294:210359:1 gene:ENSTTRG00000010633 transcript:ENSTTRT00000010657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDGGEGEDEVQFLRTDDEMVLQCNAMVLKEQLKLCLAVEGFSRLCFLXXXXXXXNVPPD
LAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHSHSGMYLSCL
TTSRSMTDKLAFDVGLQEDATGEACWWTTHPASKQRSEGEKVRVGDDLILVSVSSERYLH
LSTASGELQVDASFMQTLWNMNPICSGCEEGYVTGGHVLRLFHGHMDECLTISPADSDDQ
RRLVYYEGGSVCTHARSLWRLEPLRISWSGSHLRWGQPLRIRHVTTGRYLALIEDQGLVV
VDASKAHTKATSFCFRISKEKLDTAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAA
PDPKALRLGVLKKKAILHQEGHMDDALSLTRCQQEESQAARMIYSTGGLYNHFIKGLDSF
SGKPRGSGSPAGTALPLEGVILSLQDLIGYFEPPSEELQHEEKQGKLRSLRNRQSLFQEE
GMLSLVLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYEILASLIRGNRANCALFS
NNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLD
VLCSLCVCNGVAVRSNQDLITENLLPGRELLLQTNLINFVTSIRPNIFVGRAEGSTQYLK
WYFEVMVDEVAPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHL
WTGHVPRLVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPVV
SFSAGVKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRERLHLEPIKEYRREGPRGPHMVG
PSRCLSHDFVCPVDTVQIVLPPHLEGIREKLAENIHELWALTRIEQGWTYGPVRDDNKRL
HPCLVDFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSN
GYKPAPLDLSHVRLTPAQTMLVDRLAENGHNVWARDRVAQGWTYSSVQDIPARRNPRLVP
YRLLDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSLVESQSRWDRVRIFRAEKSYVV
QSGRWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLGPGQVGLNG
QDVSLRFFTICGSEGFEPFAINMQRPVTTWFSKSLPQFQATPREHPHYEXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XFLFKAKKAAMMTQPPATPTLPRLPREVMPADDRDDPEIILNTTTYYYSVRVFAGQEPSC
VWVGWVTPDYHQHDMNFDLSKVRVVTVTMGDEQGNIHSSLPCSNCYMVWGGDFVSPGQQG
RISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFELG
KQKNIMPLSAAMFLSERKNPTPQCPPRLEVQMLMPVSWSRMPNHFLQVDTRRAGERLGWA
VQCQEPLTMMALHIPEENRCMDILELSERLDLQRFHSHTLRLYCAVCALGNNRVAHALCS
HVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPETRAITL
FAPGKRADNGPRRYSLPGVGVTTSLRPPHHFLAPCFVAALPAAGAAEAPSRLSPSIPLEA
LRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKMI
EPEVFTEEEEDEEDEEDEEEKEEDEEEEAQEKEDAEQEEEEAAEGDKEEDLEEGLLQMKL
PESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDKLQANQRDRYSILVKAFTMTAAET
ARRTREFRSPPQEQINMLLHFKDADDEEDCPVPEEIRQDLLEFHQDLLTHCGIQLAGEEE
EPEEEATLGSRLMSLLEKVRLLKKKEEKPEEEPPAEEHKPQSLQELVSHTVVRWAHEDFV
QSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSVEDTMSLLECLGQIRSLLIVQMG
LQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFPKMVTS
CCRFLCYFCRISRQNQRSMFDHLSYLLENSGIGLGMQGSTPLDVAAASVIDNNELALALQ
EQDLEKVVSYLAGCGLQSCPILLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESVEENAN
VVVRLLIRKPECFGPALRGEGSSGLLATIEEAIRISEDPARDGPGVRRDRRRELFGEEPP
EENRVHLGHAIMSFYAALIDLLGRCAPEMHLIEAGKGEALRIRAILRSLVPLDDLVGIIS
LPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIESQEFLLHVLDVGFLPDMR
AAASLDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XRSLTKAQRDVIEECLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTNHYERC
WKYYCLPTGWANYGVTSEEELHLTRKLFWGIFDSLAHKXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXYENIDEELKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKAREGEEE
KTEKKKTRKISQSAQTYDPREGYNPQPPDLTGVTLSRELQAMAEQLAENYHNTWGRKKKQ
ELEAKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMELDTSSIE
KRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLINQYFTN
HCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVNCLHILA
RSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQTRTQVKGVGQNLTYT
TVALLPVLTTLFQHIAQHQFGDDVIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHSHFIPTIGRLRKRAGKV
VSEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNNXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGGSDQE
RTRKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQELITLAKTRYALKDTDEEVREF
LQNNLHLQGKVEGSPSLRWQMALYRGLPGREEDADDPEKIVRRVQEVSAVLYHLEXKHPY
KSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTQRACNMFVESYKAAWILTEDHSFEGRM
IDDLSKAGEQEEEEEEVEDKKPDPLHQLVLHFSRTALTEKSKLEEDYLYIAYADIMAKSC
HLEEGGENGEAEEEEIELSFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXETGAM
VSSTLKLGISILNGGNADVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAFERQNKA
EGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQTGNTTTI
NIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTEYIQGPC
TGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVMLLSLLEG
NVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGLISKKDF
QKAMDSQKQFTGPEIQFLLSCSEADENEMIDCEEFANRFQEPARDIGFNVAVLLTNLSEH
VPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEMPQVKES
KRQFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISETEGGPGEDDDEVAGAAEAGA
EGAEEGAAGPEGAAGTAAAGATARLAAAAGRALRGLSYRSLRRRVRRLRRLTAREAATAV
AALLWGALARAGSAAAGAAAGALRLLWGSLFXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXVDGEEEEVPPEPEPEKADAENGEKKEVPEPPPE
PPKKTAPPPPPPKKEEAGGGDLEFWGELEVQRVKFLNYLSRNFYTLRFLALFLAFAINFI
LLFYKVSDSPPGEDDVESSAAGDLSGAGSGGGSGWGLGAGEEAEGDEDENMVYYFLEEST
GYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITEQPEDDD
VKGQWDRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLATLEITAHNER
KPEPPPGLLTWLMSIDIKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFAAHLLDI
AMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDEDEPDMKC
DDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIVILLAIIQGLI
IDAFGELRDQQEQVKEDMETKCFICGIGSDYFDSTPHGFETHTLEEHNLANYMFFLMYLI
NKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
Download sequence
Identical sequences ENSTTRP00000010104 ENSTTRP00000010104

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]