SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010389 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010389
Domain Number 1 Region: 552-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 440-497
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.52e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 40-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.54e-24
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 4 Region: 496-553
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 596-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.12e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 402-454
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000010389
Domain Number - Region: 373-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000179
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 216-263
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000303
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number - Region: 346-386
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00078
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number - Region: 293-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00107
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010389   Gene: ENSTTRG00000010961   Transcript: ENSTTRT00000010958
Sequence length 683
Comment pep:known_by_projection scaffold:turTru1:scaffold_89705:13569:34075:1 gene:ENSTTRG00000010961 transcript:ENSTTRT00000010958 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPHPESVTDCVTVETVDQLAEGAYSSQFSAFSQEQQKMNISQASVSFKDITVELTQEEW
QQMGPIQKTLYRDVMLENYNNLVSVGNCIFKPEVIFKLEQGEEPWFLEEEFSNQSHKEDY
RDENLIKRNKKIKDKHLQQVTFINNKQLPREEEEVLRKPFNLHIVRVSSSKMSCKCDSCG
VNSQSISQFIINSRTYSTKDTDCYNVCENLPFKIKLERTHTGEKFYEYNKNQEALSYKEN
LPEHQKCQTLKQAFEFNGIGKAFYVEAACVKHKSTHTGQQSCKDEGFRKNYDKTTLFDHE
RTGTGEKHSHLNQCGKSFCEKSAIKEYNKFNMTVKHCECITSGNNFSRKSYLTQPQRTLT
EENPLVCNDRTQTGDKHFECHENRKFYQKAHKVCQRTHYEVKPYKCNECGKSFCQKGHLI
QHQRTHTGEKPFECNECGKTFSQKSHLSTHQRIHTAEKPYKCNDCGKTFVQKSTLRGHQR
IHTGEKPYECCDCGKTFVQKSTLKDHHRIHTGEKSFQCNECGKTFGQKSNLRIHQRIHSG
EKTYHCKECEKSFWRKDHLIQHQKTHTGEKPFKCNECGKTFARTSTLRVHQRIHTGEKPF
KCNECGKKFVRKAILSDHQRIHTGEKPFQCNKCGKTFGQKSNLRIHQRAHSGEKSYECNE
YGILPKKSTLSVYQRIQGGGKPN
Download sequence
Identical sequences ENSTTRP00000010389 ENSTTRP00000010389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]