SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010444 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000010444
Domain Number - Region: 28-85
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00942
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010444   Gene: ENSTTRG00000011030   Transcript: ENSTTRT00000011018
Sequence length 251
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2966:335193:340287:1 gene:ENSTTRG00000011030 transcript:ENSTTRT00000011018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYNRTSYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIRRDRQARLQRH
RHRHRRHHHHHHRRRRRRRHREYEHGYVSDRHTYSRSSHRTRYTCSPAEDWPPPLDLSSD
GDVDATVLRELYPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPALDRALDAGSGRS
PGQHQQAQRPQGQSGFRTISVDTLPPYEAVCGASPPPSGLLPLPRPEPGPRSSQDSPTPT
RAPASGPERIM
Download sequence
Identical sequences ENSTTRP00000010444 ENSTTRP00000010444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]