SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010461 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010461
Domain Number 1 Region: 28-479
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 2.49e-70
Family L-arabinose binding protein-like 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010461   Gene: ENSTTRG00000011044   Transcript: ENSTTRT00000011036
Sequence length 508
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_807:129279:141986:-1 gene:ENSTTRG00000011044 transcript:ENSTTRT00000011036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLIVLITCFVIIFATSQPCQTPGDFVAATSPGHIMMGGLFAIHEKMLSSEGYPRWPEI
QKCVGEISNFLQTLAMIYSIEMINNSTLLSGVKLGYEIYDTCIDVTEEMAAALRFKFNCS
REIVEFKCDYSRYTPRVKAVIGAGYTEITMAVFRMLNLQLMPQVSYESTAETLSDKIRFP
SFLQTVPSDFYTKAMAHLIQKCGWNWIGILTTDDDYGRLAFNTFAIQTSTNNVYIAFREV
LPAFLSDNTIEVRISQTLERIIGEQVNVVVVFLSQLHVFNLFSKAIERNINKFWIASDNW
STATKITAIPKVKRIGKVVGFTFRRRNMSSFHSFLQNLHMFPSDNNKPLNEYATSSACAY
TKDSDLSQCISNYSQGTLSYKANEDIERNFSLRNDFLDYTEPGLIHSIQLAVFALDYAIW
DLCQARDSQNPNAFQPWELLDVLKNVMFTDGGSSFHFDAHGDMNTGYDVVLWKINSHMTI
ARMAQYNLKNDVFIVTDQETKNEFRNLK
Download sequence
Identical sequences ENSTTRP00000010461 ENSTTRP00000010461

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]