SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000010934 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000010934
Domain Number 1 Region: 39-131
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.24e-38
Family SCAN domain 0.0000505
Further Details:      
 
Domain Number 2 Region: 489-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.6e-23
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 3 Region: 590-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-18
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 394-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.33e-16
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 231-291
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000000144
Family KRAB domain (Kruppel-associated box) 0.0038
Further Details:      
 
Domain Number 6 Region: 545-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000159
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000256
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000010934   Gene: ENSTTRG00000011530   Transcript: ENSTTRT00000011530
Sequence length 647
Comment pep:known_by_projection scaffold:turTru1:scaffold_84773:83010:88509:1 gene:ENSTTRG00000011530 transcript:ENSTTRT00000011530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATALEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRRFRYQEAASP
REALIRLRELCHQWLRPERRTKEQILELLVLEQFLTVLPGELQSWVRGQRPESGEEAVTL
VEGLQKQPRRPRRWVTVHVHGQEVLSEETVHPGAEPESPSELQDPAHTLTPEESHEETTQ
SPDLGAPEEQSLCQELEFQPLQESEVPVPQDPALPEERNPGNPEMVALLTALSQGLVTFK
DVAVCFSQDQWSDLDPTQKEFYGEYVLEEDCGIVVSLSFPIPRLDEISHMGEEEPLIPEI
PEAQEPQEPEILSFTYTGDRSEDEECPEQADLSLEELHRSILGDAEIHQTPDWEIVFEGD
PGRLNERRFGTNISQVHSLTNLQETVPVHPLLGRHHDCTVCGKSFTCNSHLVRHLRTHTG
EKPYKCMECGKSYTRSSHLARHQKVHKMSAPYKYPLNRKNLHETSPLVQVERTPPVEKPY
RCDDCGKHFRWTSDLVRHQRTHTGEKPFFCTICGKSFSQKSVLTTHQRIHLGGKPYLCGE
CGEDFSDHRRYLAHRKTHAAEELYLCSECGRCFNHSAAFAKHLRGHASVRPCRCTECGKS
FGRRDHLVRHQRTHTGEKPFTCPTCGKSFSRGYHLIRHQRTHSGKTS
Download sequence
Identical sequences ENSTTRP00000010934 ENSTTRP00000010934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]