SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011050 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011050
Domain Number 1 Region: 583-754
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-39
Family SPRY domain 0.0000805
Further Details:      
 
Domain Number 2 Region: 3-88
Classification Level Classification E-value
Superfamily DEATH domain 9.77e-24
Family Pyrin domain, PYD 0.0044
Further Details:      
 
Domain Number 3 Region: 355-419
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 7.02e-16
Family B-box zinc-binding domain 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000011050
Domain Number - Region: 292-347
Classification Level Classification E-value
Superfamily RING/U-box 0.000177
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011050   Gene: ENSTTRG00000011650   Transcript: ENSTTRT00000011652
Sequence length 761
Comment pep:known_by_projection scaffold:turTru1:scaffold_89945:62842:75871:1 gene:ENSTTRG00000011650 transcript:ENSTTRT00000011652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKTRSDHLLYSLEELVPYDFEKFKFKLQNTSLEKEHSRIPRGQLQTAKPVKLATLLVTH
YGEEDAVRLTLQVLRAINQHLLAEELNSAIGPGCQVKESDTDSSAMSGSSGEIKPKSLKI
PDGLEGDKQRQSGDGAGCPPSIQPEAGRGPQKKPLGKQRDQKGSERLDVQGKPGARNTTL
SSKRSPCPSKPQGEKGSNVGVRLRRNASSAGRLQGLSWVALGRREFKISEAYLPSGKKRP
KSLEFTISSGETEPLNPETLMLQEKMRCENPGSAATLNTGATVAAEKGSRKPERLQDKAV
CPLCCAQEGDPVGGSCVHVSCSCPVASRDPEVSRGYSSSCPQCQDLLPGKSHGSLSPKSL
PQCERHMKQVQLLFCEDHGEPICLICGLSQEHRGHRVRPIEEAALEYKKQIQKQLEHLKE
LRKSGEEQRSQGDKKTANFLKQAETQKQRIQYQLEQLCQFLEQQEQLFVACLEELGQTIG
QVRETYGTRVTGDIALLDKLIGELEAKQCQPEWELMKDVRVTLHRAKKVTVPELWATPPE
VKEKIHLLYQKSEFVEKRMRHFLETLRSEMEMFNVPEVTGGQALNVILEAEAAHPNLIFS
DDLKSVRLGKKWDRLPASPERFYSIIALGSLSLLSSCHYEVKVGDKTGWVLGVCKAATSS
KENMALSPENSYWVEMMMKNECQASNFPSTRMREPPRHVGIFLNYKTGDISFYTVTAKSH
ISTSIGFFSSGPLQPIFSPRTHDGENMDPLNIRPVGGQGPH
Download sequence
Identical sequences ENSTTRP00000011050 ENSTTRP00000011050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]