SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011323 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011323
Domain Number 1 Region: 225-489
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-75
Family Protein kinases, catalytic subunit 0.0000000035
Further Details:      
 
Domain Number 2 Region: 115-257
Classification Level Classification E-value
Superfamily SH2 domain 3.9e-36
Family SH2 domain 0.00000259
Further Details:      
 
Domain Number 3 Region: 38-173
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-22
Family SH3-domain 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011323   Gene: ENSTTRG00000011940   Transcript: ENSTTRT00000011938
Sequence length 501
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1447:12511:31332:1 gene:ENSTTRG00000011940 transcript:ENSTTRT00000011938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVVSSKRQVKEKGKGRWSPEKASTQGKEAPPLPPLVVFNHVAPPPPDTRHPDQEEHFVV
ALYDYKAVNDRDLQMLKGEKLQILKEAGDWWLAKSLITGREGYVPSNFVTRIETLEVEKW
FFRSICRRDAERQLLAPINKAGSFLIRESETSKGAFSLSVKDVTTQGEVIKHYKIRSLDE
GGYYISPRNTFPTLQALVQHYSKKGDGLCQRLTQPCVSLALQNPWAQDEWEIPRQSLKLV
RKLGSGQFGEVWMGYYKNNIKVAIKTLKEGTMSPEAFLGEANLMKTLQHERLVRLYAVVT
KEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAYIEQMNSIHRDLRAA
NILVSETLCCKIGDFGLARIIDNEYTAQEGAKFPIKWTAPEAIHFGVFTIKADVWSFGIL
LMEIITYGRVPYPGMSNPEVIGNLGRGYRMPRPDSCPPELYSSVIAECWRSRPEERPTFE
FLQSVLEDFHTATEGQYELQP
Download sequence
Identical sequences ENSTTRP00000011323 ENSTTRP00000011323

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]