SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000011738 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000011738
Domain Number 1 Region: 22-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2e-113
Family Transferrin 0.00000022
Further Details:      
 
Domain Number 2 Region: 412-580
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.25e-59
Family Transferrin 0.00000962
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000011738   Gene: ENSTTRG00000012374   Transcript: ENSTTRT00000012371
Sequence length 581
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2335:529:20363:-1 gene:ENSTTRG00000012374 transcript:ENSTTRT00000012371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPSVALWLILALRTALGGMEVRWCTISDPEQQKCSDMSKAFQQASIQPSLLCVQGTSA
DHCIQLITAREADAITLDGGAIYEAGKEHGLKPVVGEVYDQEVGTSYYAVAVVKRGSPVT
INTLKGVTSCHTGINRTVGWNVPVGYLVESGRLSVMGCDVLKAVSDYFGGSCVPGAGETS
YSESLCRLCRGNTAGEGVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGQPLLSQNFELLCRDGSRADVTEWRRCHLARVPAHAVVVRADTDGGLIFRLLNEGQ
RLFSHEGSSFQMFSSEAYGQKNLLFKDSTSELVPIATQTYEAWLGREYLHAMKGLLCDPN
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGQIDAVTL
KGQDIYTAGKIYGLVPAAGEHYAPEDRSNSYFVVAVVKRNSSAFTLDELRGKRSCHGFGS
PAGWDIPVGALVQRGFIRPRDCDVLTAVSEFFSASCVPVNNPKNYPSSLCALCVGDEQGH
NKCVGNSQERYYGYSGAFRCLAENAGDVAFVKHTTVFDNTN
Download sequence
Identical sequences ENSTTRP00000011738 ENSTTRP00000011738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]