SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012245 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012245
Domain Number 1 Region: 3-510
Classification Level Classification E-value
Superfamily SIS domain 4.17e-214
Family Phosphoglucose isomerase, PGI 0.00000000000000863
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012245   Gene: ENSTTRG00000012903   Transcript: ENSTTRT00000012908
Sequence length 514
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_649:444145:468289:1 gene:ENSTTRG00000012903 transcript:ENSTTRT00000012908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNLNTNHGHILLDYSKNLVTEAVMQMLVDLAKSRGVEAARERMFNGEKINFTEDRAVLHV
ALRNRSNTPILVDGKDVMPEVNRVLEKIKSFCHRVRSGEWKYSKSITDVINSIGGSDLGP
LMVTEALKPYSSEGPRVWFVSNIDGTHIAKTLAALKPESSLFIIASKTFTTQETITNAET
AKEWFLLSAKDPSAVSKHFVALSTNTAKVKEFGIDPQNMFEFWDWVGGRYSLWSAIGLSI
ALHVGFDNFEQLLSGAHWMDQHFRTTPLEKNAPVLLALLGVWYINCFGCETHAMLPYDQY
LHRFAAYFQQGDMESNGKYITKSGTRVDHQTGPIVWGEPGTNGQHAFYQLIHQGTKMIPC
DFLIPVQTQHPIRKGLHHKILLANFLAQTEALMRGKSTEEARKELQAAGKSPQDSEKLLP
HKVFEGNRPTNSIVFTKLTPFILGALIAMYEHKIFVQGIIWDINSFDQWGVELGKQLAKK
IEPELDGSSPVTSHDSSTNGLINFIKQEREARSQ
Download sequence
Identical sequences ENSTTRP00000012245 ENSTTRP00000012245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]