SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012395 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012395
Domain Number 1 Region: 81-131
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000489
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 2 Region: 483-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000714
Family Classic zinc finger, C2H2 0.0024
Further Details:      
 
Domain Number 3 Region: 715-770
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000111
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 4 Region: 533-560
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000796
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 5 Region: 623-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000109
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 573-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000317
Family Classic zinc finger, C2H2 0.058
Further Details:      
 
Domain Number 7 Region: 778-802
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000116
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012395
Domain Number - Region: 139-170
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00622
Family Classic zinc finger, C2H2 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012395   Gene: ENSTTRG00000013062   Transcript: ENSTTRT00000013063
Sequence length 884
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_524:103252:109300:-1 gene:ENSTTRG00000013062 transcript:ENSTTRT00000013063 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPFCVGGGRRLPGSSKSGPGRDGGRNEVRLPMLHDPPKLGLPVGRGGPTVPSQAPLCF
DPGSPASDRTKGKKKGRPKAENQALRDIPLSLMNQWKDEFKAHSRVKCPNAGCWLEFPSI
YGLKYHYQRCQGGAISERLAFPCPFCEAAFTSKTQLEKHRIWNHMDRPLPAPKPGPVSRP
VSVSRPVGVSKPIGVSKPVTVSKPIGISKPVTVGRPVPVSKPVPASRPVPVTKAVPASRP
IPVTRSVPXXXPVTVNKPAPVTKPVTINKPVSVTKLVTGTKPVPVAKPVTVSRPIVVSKP
VTVSRPIAISRHTPPCKMVLLTKSENRAPRAAGRSSGKRAADGLDACPLPPKQARPENGE
YGPSTTDQSSAFQLSTDPSSSPLSLGSRALGGKEAPRAAGPVSPPEEGAERTKHRRKQKT
PKKFTGEQPSISGTFGLKGLAKAEDKARIHRAKKQEGPVPEEVRKRGPAPSSAVSKEVPA
PGAHPAPGGPEEQWQRAIHERGEAVCPTCNVVTRKTLVGLKKHMEVCQKLQDALKCEHCR
KQFKSKAGLNYHTMAEHSAKPCDAEASEAGEREEREWLRKVLKQVGRLRCPQEGCGAAFS
SLMGYQYHQRRCGKPPCEVETPSFPCTHCGKTYRSKAGHDYHVRSEHAAPPPEEPADKGP
EAEDLLGVERTPSGRIRRTSAQVAVFHLQEIAEDELARDWTKRRMKDDLVPETARLNYTR
PGLPVLNPQLLEEWKNEVKEKGHVNCPNDCCEAIYSSVSGLKAHLASCSKGDHLVGKYCC
LLCPKEFSSESGVKYHILKAHAENWFRTSADPPPRHKGPDSLVPRKEKSPAGGKKRGRKP
KERPPEDPAPGTPPHRDDWPPGGRDKGARGSAGRKVGAGKAPEK
Download sequence
Identical sequences ENSTTRP00000012395 ENSTTRP00000012395

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]