SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012607 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012607
Domain Number 1 Region: 458-515
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 598-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.57e-26
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 514-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.69e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 4 Region: 668-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.82e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 24-86
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 6 Region: 420-472
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.36e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 377-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000518
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 8 Region: 561-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000261
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 321-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000367
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 196-244
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000105
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012607
Domain Number - Region: 234-285
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00186
Family Classic zinc finger, C2H2 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012607   Gene: ENSTTRG00000013289   Transcript: ENSTTRT00000013288
Sequence length 727
Comment pep:known_by_projection scaffold:turTru1:scaffold_113734:14633:66767:1 gene:ENSTTRG00000013289 transcript:ENSTTRT00000013288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NQENSALRPLTAEPQFLSQEQKMNIPQASVSFKDVTVEFTQEEWWQMDSAQRTLYRDVML
ENYSHLVSVXXXXXXXXXIFMLEQGEDPWLLEKEFVNRSSPEESQPDELLQESLENQGKH
LRQVLFVNKSLTTEQEISRKLCTLDINIFPAETMPCKFDTTGSTYLLLSSLTPHCQYSRK
KAYELNVCENWLLSIKDRRTNTGEKSFVYSKSVKAFGHKDKVIQHQTIQTLQQTFEYNEC
GKDFLEKTALVTSKDTHPTVKSYKFSKFGENQYDKSTLIISQSNHPEEKSHYEFNKYEYT
IDKNRNNFSRITQRTDTEGKSFSQKLHIREQQKIHIGVKPFEYGKNFSHNSTLQVHQRIH
TIDQSSDYGTCTESLAYQSTFNVHKRTQITVKPYECNECGKSCTMTSCLIQPQKSFTEEK
PYECHECGKAFSEKSRLRKHQRTHTGEKPYKCDGCEKAFSAKSGLRIHQRIHTGEKPFEC
NECGKSFNYKSILIVHQRTHTGEKPFECNECGKSFSHMSGLRNHRRTHTGERPYKCDECG
KAFKLKSGLRKHHRTHTGEKPYKCNQCGKAFGQKSQLRGHHRIHTGEKPYTCNHCGEAFS
QKSNLRVHHRTHTGEKPYKCDECGKTFRQKSNLRGHQRTHTGEKPYECSECAKAFSEKSV
LRKHQRTHTGEKPYNCNHCGEAFSQKSNLRVHQRTHTGEKPYKCDKCGKTFSQKSSLREH
QKAHTEN
Download sequence
Identical sequences ENSTTRP00000012607 ENSTTRP00000012607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]