SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012673 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012673
Domain Number 1 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.58e-24
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.83e-22
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 502-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.07e-22
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 614-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.6e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 6 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.84e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 7 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-20
Family Classic zinc finger, C2H2 0.0097
Further Details:      
 
Domain Number 8 Region: 224-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.44e-17
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 9 Region: 561-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.96e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 656-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000106
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 11 Region: 724-768
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000441
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012673   Gene: ENSTTRG00000013355   Transcript: ENSTTRT00000013358
Sequence length 790
Comment pep:novel scaffold:turTru1:scaffold_109204:35934:48657:-1 gene:ENSTTRG00000013355 transcript:ENSTTRT00000013358 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVSQEQLTFKDIDIEFSQEEWECLEPAQQALYRDVMLETYRNLLSLGLFLNILPTLQEK
EPAIVRVPDCIKLNVDISPMHVIKKLQLKVNTGRGEVLQKVMLGRHERNKVKRFNLRRIQ
ENISDFEPQQRDEVRNYKGTPMSHNENPTDKRDGLGRSVAGIKPIENRLASSFRDELHIF
KSEQKIGEFNQADKNINSSASFSPPQTVTPVVQTSISDTNGNDFVHPSVLTQDQRAHREQ
PYKCNECGKVFSQNSDLAVHQRTHTGEKSYKHNVCGKTLDHGSHIAGHQVIHTEEKFYKC
DMCEKVFSHKSNLAVHQRIHTAEKPYKCNVCDKVFNHNSNRRRHQLIHTGAKPYKCDVCG
RVFNRSSILAHHQRIHTGEKPYKCNECGKVFSRKGTLASHQRIHTGEKPYKCNECGKTFY
HSSILARHQIIHKGVRIYKCDVCGKVYSRNSNLAVHQRTHTGEKPYKCNECGQVFSQKAA
LACHQAVHTGEDPYKCNVCGKAFSVRSYLAKHRRIHSGEKPYKCNDCGKVFIKKAILAIH
QKIHTGEEPYKCGECGKVCSLKASLAKHQVIHTQERCHICNECGKTFHQSSTLTRHQIMH
RVEKLYKCDVCGRMFSQNSYLERHQRIHTGEKPYKCNECGKAFSQNPTFAKHQRIHTGKK
PYKCNCGKVFIQNSLLASHCRIHAVEKPFKNIECKGFTQISTLTTHVIHARQKPKCNECL
KVSQNSYLNIHRRIYTGEKSFIMCGISFSLLSVLPYHQVIHTGERLYKRIYDQAFGENIH
QRIHSGLPHK
Download sequence
Identical sequences ENSTTRP00000012673 ENSTTRP00000012673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]