SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012881 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012881
Domain Number 1 Region: 17-106
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.8e-36
Family SCAN domain 0.0000696
Further Details:      
 
Domain Number 2 Region: 447-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000464
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 416-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000186
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 536-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000318
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 233-264
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000222
Family KRAB domain (Kruppel-associated box) 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012881   Gene: ENSTTRG00000013574   Transcript: ENSTTRT00000013574
Sequence length 600
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2259:61147:94186:-1 gene:ENSTTRG00000013574 transcript:ENSTTRT00000013574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSPPGENPSPQGELPSPESSRRLFRRFCYQEAAGPREALHRLWDLCRGWLRPERHTKEQ
ILELLVLEQFLAILPREVQGWVRAQEPESGDQAVAAVEALEREPGRPWQWLKHCEDPVVI
DDGDSPPDQEQERLPAEPQSDLAKSQDAQPMALPQGPGLPSRLSGQLSGDPVLQDTSLLQ
EASLRDAQQVTALQLPPGFFLFNNNHSSSYSEILGNGKKARIISAPSHNRANRVSSFKDM
IFCFSEEDWSLLDPAQTGFYGEFIIGEDCGVSLPPDDPATQLDLSQGEENEPRVPELQDL
QGKDVSQVSYADFPSLQPFQTEERRKRDEPQVPEFQICQQTVLPPSTCPAGGDAPFPDNS
LDEEVTIEIVLSSSGDEDSQLGPYCTDELQSPTEKQHSLPTSHRSGPESGGEVQTSSKKS
YVCPNCGKIFRWRVNFIRHLRSRREQKPHECSVCGELFSDSEDLDGHLETHEVQKPFRCG
ACGKSFRLNSHLLSHRRIHLQPDRLELLKKREQEASGTVGGDSDALLAKGKAKLRFQCCD
CGKVFQRPDQLARHRSSTHVDKSRPFQCRYCVKSFSQNSDLLRHQRLHMKRRSKQALNSY
Download sequence
Identical sequences ENSTTRP00000012881 ENSTTRP00000012881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]