SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012990 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012990
Domain Number 1 Region: 216-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 328-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.95e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 272-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-23
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 4 Region: 26-86
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.45e-23
Family KRAB domain (Kruppel-associated box) 0.00098
Further Details:      
 
Domain Number 5 Region: 370-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 132-189
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.48e-19
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 180-211
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000203
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012990   Gene: ENSTTRG00000013694   Transcript: ENSTTRT00000013692
Sequence length 428
Comment pep:known_by_projection scaffold:turTru1:scaffold_110746:56560:72712:-1 gene:ENSTTRG00000013694 transcript:ENSTTRT00000013692 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPHLISSLLWGAEEKETMHAELIQAVFRGSVMFRDVSINFSQEEWECLDSGQMNLYKEVM
LENFSNLVSVGLSSSKPTVISLLEQGKEPWMVDRELTRGLCSDLESMCETKLLSLKKRHF
SQVMFTHEDIPTFIQPTFLIPHQKTINEEKPCECKICGKAFNQNSHFVQHQRIHSAEKNY
ECKECGKSFSRGSLVARHQRIHTGEKPYECKECGKAFSCSSYFSQHQRIHTGEKPYECKE
CGKAFNYCSNLNDHQRIHTGEKPYECKVCGKAFTKSSQLFPHLRIHTGEKPYECKECGKA
FTQHSRLIQHHRMHTGEKPYKCKECEKAFSSASTLTNHHRIHAGKKLYECKECGKAFIQS
SELIQHQRIHTDEKPYECNECGKAFNKGSNLTRHQRIHTGEKPYDCKECGKAFGSRSDLI
RHEGIHIG
Download sequence
Identical sequences ENSTTRP00000012990 ENSTTRP00000012990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]