SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013136 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013136
Domain Number 1 Region: 482-713
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.02e-33
Family Voltage-gated potassium channels 0.012
Further Details:      
 
Domain Number 2 Region: 94-248,293-363
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.32e-31
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 1466-1694
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.91e-27
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 1145-1237,1267-1312,1391-1417
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000235
Family Voltage-gated potassium channels 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013136   Gene: ENSTTRG00000013845   Transcript: ENSTTRT00000013851
Sequence length 2178
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3266:160947:555900:1 gene:ENSTTRG00000013845 transcript:ENSTTRT00000013851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRFGDELGGRYGGAGGGERARGGGAGGAGGPGPGGLQPGQRVLYKQSIAQRARTMALYN
PIPVKQNCFTVNRSLFVFSEDNVVRKYAKRITEWPPFEYMILATIIANCIVLALEQHFPD
GDKTPMSERMDDTEPYFIGIFCLEAGMKIVALGFVLHKGSYLRNGWNVMDFVVVLTGILA
TAGTDFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMVPLLQIGLLLFFAILMFAII
GLEFYMGKFHKACFPNSTDAEPVGDFPCGKEAPARLCEGDTECREYWPGPNFGITNFDNI
LFAVLTVFQCITMEGWTDILYNTNDAAGNTWNWLYFLPLIIIGSFFMLNLVLGVLSGEFA
KERERVENRRAFLKLRRQQQIERELNGYLEWIFKAEEVMLAEEDKNAEEKSPLDAVLKRA
ATKKSRNDLIHAEEGEDRFADLCAVGSPFARASLKSGKTESSSYFRRKEKMFRFFIRRLV
KAQSFYWVVLCVVALNTLCVAMVHYNQPQRLTTALYFAEFVFLGLFLTEMSLKMYGLGPR
SYFRSSFNCFDFGVIVGSIFEVVWAAIKPGTSFGISVLRALRLLRIFKVTKYWSSLRNLV
VSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFQDETPTTNFDTFPAAILTVFQX
XTGEDWNAVMYHGIESQGGVSKGMSSVYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXISIAAXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXRHKAPSAHEEAEKEAAAEKEGEVGDRDEDKEFRNHQPRE
PHCDLEASGVMGVGPVHALPSTCLEKVEEQPEDADNQRNVTRMGSQPSDLSTTVHIPVML
TGLPGETTVVSSGNVDLESQAEGKKEVEADGVLRNGPRPIVPYSSMFCLSPTNLLRRFCH
YIVTMRYFEMSILVVIALSSIALAAEDPVQTDSPRNNVLKYMDYIFTGVFTFEMVIKXID
LGLLLHPGAYFRDLWNILDFVVVSGALVAFAFSXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXAVFDCVVNSLKNVLNILIVYMLFMFIFAVIAVQLFKGKFFYCTDESKELERDCXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVLKHSVDATYEEQGP
SPGYRMELSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKVMSECSLEKNERACIDFAI
SAKPLTRYMPQNKQSFQYKTWTFVVSPPFEYFIMAMIALNTVVLMMKFYDAPYEYELMLK
CLNIVFTSMFSMECALKIIAFGVLNYFRDAWNVFDFVTVLGSITDVLVTEIAGTNNFINL
SFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIVGMQVFGNI
ALDDDTSINRHNNFRTFLQALMLLFRSATGEAWHEIMLSCLGSRACDALANAAECESDFA
YFYFVSFIFLCSFLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGRI
SYNDMFEMLKHMSPPLGLGKKCPARVAYKHTQEGGIKESVSWGTQRTQEVPCEVTTPLER
GHSVEIPVVQAVDVQMQSMALRGPDGEPQPGLESQGRAASMPRLAAETQPVPDTSPMKRS
ISTLAPQRPPVARLCNAALDRAPASQAAPHHHHRCHRRRDRKPRSLEKGPSLSADIDGAP
NSAAGPGPPPGDGPAGCRRERRQERGRSQERRQPSASSEKQRFYSCDRFGGREPPQPQPP
LSSHPPTPSPDAGQEPGPPRQGSASANGSPLLPTPGASTPGRGGRRQLPQTPLTPRPSVA
YKTANSSPVHFAGAYTSLPAFSPGRLSRGLSEHNALLQRDPLSQPLAASSRIGSDPYLGR
RLDSEAAARTQPEDTLTFEEAVATNSGRSSRTSYVSSLTSQSHPLRRVPNGYHCTLGLSS
GGGGRRHSYHHPDQDHWC
Download sequence
Identical sequences ENSTTRP00000013136 ENSTTRP00000013136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]