SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013303 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013303
Domain Number 1 Region: 527-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-27
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 387-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.97e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 443-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.29e-26
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 5 Region: 333-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.45e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 627-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-22
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 7 Region: 490-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000265
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 65-124
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000863
Family KRAB domain (Kruppel-associated box) 0.0056
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013303
Domain Number - Region: 280-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000585
Family Classic zinc finger, C2H2 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013303   Gene: ENSTTRG00000014028   Transcript: ENSTTRT00000014027
Sequence length 690
Comment pep:known_by_projection scaffold:turTru1:scaffold_112763:48132:71522:1 gene:ENSTTRG00000014028 transcript:ENSTTRT00000014027 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRACAGSRRAADARDLRPLPCLEESMEERDEKPPGPLKASAQXXXXXXXXXXXVERDDAG
SLAVASQEGVNFHRVTVDFTQEEEGTLNPARRTLDRGVILENHRHLVSWESATALGRRES
TSKQSSFGDEPSYRVKIERLTRDDPWLSSCEEVQDCKELLEKQQEKQERLLKEVTFTHRT
AISHERACKSDDLEEKRGPNNSLLSPQMIPIRNHFHKHASHVKKFHYNSMVNTHQMINDS
EKLCENKECGNLPQSIHFFQFTKAQTEDKSYGFSDSIQHFSHDKPLNLHEKIHAQGKSFD
FKEHGQVLNHSISHNEQQRIPVEESQYKCNKTSQSSSLAQNMRNHSEEKPFECNQCGKSF
SWSSHLVAHQRTHTGEKPYECNECGKSFSRSSHLVSHQRTHTGEKPYRCNQCGKSFSQSY
VLVVHQRTHTGEKPYECSQCGKSFRQSYKLIAHQRTHTGEKPYECNQCGKSFIQSYKLIA
HQRIHTGEKPYECNQCGKSFSQSYKLVAHQRSHTGEKPFECNQCGKSFSWSSQLVAHQRT
HTGEKPYECNECGKSFNRSSHLVMHQRTHTGEKPYECNQCGKSFSQSYVLVVHQRTHTGE
KPYECSQCGKSFRQSSCLTQHQRTHTGEKPYECNQCGKTFSLSARLIVHQRTHTGEKPFT
CNQCGKAFINSSKLIRHQATHIEEKPYECN
Download sequence
Identical sequences ENSTTRP00000013303 ENSTTRP00000013303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]