SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013707 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013707
Domain Number 1 Region: 902-1193
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 3.49e-88
Family Complement components 0.0000155
Further Details:      
 
Domain Number 2 Region: 1274-1402
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 4.71e-31
Family Alpha-macroglobulin receptor domain 0.0018
Further Details:      
 
Domain Number 3 Region: 737-789
Classification Level Classification E-value
Superfamily E set domains 0.00000000392
Family SVA-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013707   Gene: ENSTTRG00000014458   Transcript: ENSTTRT00000014458
Sequence length 1440
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2104:4032:121673:1 gene:ENSTTRG00000014458 transcript:ENSTTRT00000014458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGPRLGTAARLFCVWSAALAAAPRPKFLVTAPGIIRPGGNVTIGVELLEHSPSQVTVKA
ELVKIAANLAVSVLEAEGVFEKGSFKTLTLPPLPLNSGDEIYELHVTGRAQDEILFSNXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDPKSNLIQQWL
SEQSDLGVVSKTFQLSSHPMLGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCS
LNSVSLNGTVTAKYTYGKPVKGDLTLTFLPLSFWGVKKNITKTFKINGSANFSFNDEEMK
KVMDFSDGLSEHMNLSSPGPVEILATVTESLTGISRNASSNVFFKQHDYIIEFFDYATVL
KPSLNFTATVKVTRSDGNQLTPEERRNNVVVMVTQRNYTEYWNRWDGRNQEIGAVQIVNH
TVPPNGIFKIEFPILDDSSELQLKASFLDAVSSMAVHDMFKSPSKTYIQLKTRDENIKVG
SPFELVLSGNKQLKEFSYMVVSRGQLVAVGKQNSTTFSLTPENSWAPKACIIVYYIEDDG
EIINDVLKVPVQLVFKNKIQLFWSKASAEPSERVSLRITVTQPNSIVGVVAVDKSVNLMN
VSNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLVKDFIDVYDRIAFL
EEYEGYLVDFHDFSSGSSPRVRKHFPETWIWLDTSMGSRTYQEFEVTVPDSITSWVATAF
VISEDLGLGLTTTPVELQSFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKDATEVKVIIE
KSDTFDILMASNEINVTGHQQTVLVPSEDGATVLFPVRPTHLGEMPITVTAVSPAASDAV
TQRILVKAEGIEKSYSQSILLDLTDSKLQTTLKTLSFSFPPHIVSGSERVQITAIGDILG
SSISGLASLIRMPYGCGEQNMINFAPNIYVLDYLTKKKQLTENLKEKALSFMRQGYQREL
LYQREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADPYIDIDQNVLHRAYAWLKGHQKSNG
EFWEPGKVIHSELQGGNKSPVTLTAYIVTSLLGYKKYQPNSDVQESINFLESEFDRGISD
NYTLALVTYALSSVRSPKAKDALNMLTWRAEQEGDMQFWVSPVSRLSESWQPSSLDIEVA
AYALLSHFLQHQISEGIPIMRWLSRQRNSLGGFASTQDTIVALKALSEFAALMNTEETNI
QVTVVGSGSLSPVKFVISTQNRFLLQTAEXXXXXXXXXXXXXXXXXXXXXXLNVIYNVKE
SRSSIIHRSIQDQEAFDLDIAVKDDKDDINHLNLNVCTRFLGPGRSGMALMEINLLSGFT
VSSDAISLSETVKKVEHDHGKLNLYLDSVNETQFCVDIPSVRNFRVSNTQDASVSIMDYY
EPRRQAVRSYNSRAQLSSCDLCGDAHACGPCDSVASASLSHPNACLLVCFMLLFSLQCWL
Download sequence
Identical sequences ENSTTRP00000013707 ENSTTRP00000013707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]