SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014068 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014068
Domain Number 1 Region: 467-570
Classification Level Classification E-value
Superfamily SRCR-like 3.27e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00016
Further Details:      
 
Domain Number 2 Region: 341-445
Classification Level Classification E-value
Superfamily SRCR-like 5.1e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000835
Further Details:      
 
Domain Number 3 Region: 186-289
Classification Level Classification E-value
Superfamily SRCR-like 1.1e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0001
Further Details:      
 
Domain Number 4 Region: 55-161
Classification Level Classification E-value
Superfamily SRCR-like 1.29e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014068   Gene: ENSTTRG00000014839   Transcript: ENSTTRT00000014839
Sequence length 571
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2214:171588:180537:-1 gene:ENSTTRG00000014839 transcript:ENSTTRT00000014839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TRKDTEMQVGPQPDEKSRGWRLGDRNAAPSPLTPVLSFLLLLPLASALQPTSLPFPELRL
VGGPSRCRGRLEVHGGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPRPLAFGQGRGPIL
LDNVECRGQEAALSECGSRGWGVHNCFHYEDVAVLCDEFLPTQPPTRKVLTSRAPPTTPQ
NGKGEGSVRLVGGAGPCQGRVEILHGGLWGTVCDDDWGLPDATVVCRQLGCGAALAATTN
AFFGYGTGHILLDNVHCEGGEPRLAACLSLGWGVHNCGHHEDAGALCAXXXXXXXXXXXX
XXXXXXXXXXXXXXXTGVGALPSREPALFTTAAWAAGKKSGRLRLVGGPSPCRGRVEVLY
AGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLDNVGCAGTEARLS
DCFHLGWGQHNCGHHEDAGALCSGPDELVQQDGAETTQVPTPRPRDGHLRLANGAHRCEG
RVELFLGQQWGTVCDDAWDMRAAGVLCHQLGCGQALAAPGEAHFGPGRGPILLDNVKCRG
DESALLLCSHIRWDAHNCDHSEDASVLCQPS
Download sequence
Identical sequences ENSTTRP00000014068 ENSTTRP00000014068

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]