SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015083 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015083
Domain Number 1 Region: 77-301
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.44e-56
Family Voltage-gated potassium channels 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015083   Gene: ENSTTRG00000015918   Transcript: ENSTTRT00000015917
Sequence length 381
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2276:298058:299203:1 gene:ENSTTRG00000015918 transcript:ENSTTRT00000015917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFLDSCCSNRYHELKEENHEKDWDQKSNDVSTDSSFEESSLFEKELEKFDKLRFGQLRKK
IWIRTENPAYCLSAKLIAISSLSVVLASIVAMCIHSMSEFQNEDGEVDDPVLEGVEIACI
AWFTVELAVRLVAAPCQKKFWKNPLNIIDFISIIPFYATLAVDTKKEESEDIENMGKVVQ
ILRLMRIFRILKLARHSVGLRSLGATLRHSYHEVGLLLLFLSVGISIFSVLIYSVEKDDH
TSSLTSIPVCWWWATISMTTVGYGDTHPVTLAGKLIASTCIICGILVVALPITIIFNKFS
KYYQKQKDIEVDQCSEDPPEKCHELPYFNIRDTYAQRMHAFLTSLSSVGIVVSDPEATDA
SSIDENEDVYNTASLENCTAK
Download sequence
Identical sequences ENSTTRP00000015083 ENSTTRP00000015083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]