SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015472 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015472
Domain Number 1 Region: 331-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 275-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-20
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 4-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.24e-19
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 4 Region: 386-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-18
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 5 Region: 233-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-18
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 430-482
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.53e-16
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 143-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000386
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015472   Gene: ENSTTRG00000016323   Transcript: ENSTTRT00000016323
Sequence length 507
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_371:4723:7486:1 gene:ENSTTRG00000016323 transcript:ENSTTRT00000016323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCAISEDVFVYFSREEWVLLDEDQRLLYRDVMLENFALLASLGITSSRSYLVTQLEQGEE
PWMPAQVDMTAATEKEAQKGPGPGCWCGVEAEAVSSEQSVYLEGVSQFRTPVAGLKTHPC
DMSGPILKDLLHLTEYPWGKARQEPHICEAHGKQFWFSADLHQHHKQHSGEKFFRRDEGR
DTVKSCRICVPEKTYIHGESRVDLPATSGLQHQVSHDRMKPHKSTELGGALSTGQKLHKC
SQCGKVFTRKDTLARHQRIHTGERPYECSQCGKFFSQSCDLFKHQTVHTGERPFECSECG
KFFRQVSGLVEHRRVHTGERLYQCSNCGKFFSSKSNLIRHQEVHTGAKPYVCSECGKEFN
RRHTLVLHQRTHTGERPYECRECGKSFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLV
QHQKVHSGEKPYECSRCGKAFTQRPNLIRHWKVHTGERSSECRECGKDFNHRHTLLLHQR
THTGERESTVVQEAFPALPTCCTLESI
Download sequence
Identical sequences ENSTTRP00000015472 ENSTTRP00000015472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]