SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015583 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015583
Domain Number 1 Region: 230-382
Classification Level Classification E-value
Superfamily Ribonuclease H-like 3.15e-26
Family DnaQ-like 3'-5' exonuclease 0.0011
Further Details:      
 
Domain Number 2 Region: 506-665
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000000192
Family Canonical RBD 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015583   Gene: ENSTTRG00000016439   Transcript: ENSTTRT00000016439
Sequence length 774
Comment pep:novel genescaffold:turTru1:GeneScaffold_208:91324:134338:1 gene:ENSTTRG00000016439 transcript:ENSTTRT00000016439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPEKEMTGRTPKKGRKRRRVPNKLVGASEVMRDRSDLEERQQPEAKKACLSTILLSDTR
EITHGQLCELLKYAVLGKSSVPKPSWCQLFHQNHLNNVVVVILQGMSQLHFYRFYLEFGL
LRKAFRHKFCLPPPSSDFLADIIGLQKKQIIGDLPKGMEGSLPSSSSEVSINLQNDPIVK
KYGSKKVSLTRCLLTKEEMKTYHFPLQGFPDCENFVPIKCCGSITNNSPLFGLDCEMCLT
SKGRELTRISLVAEGGCCVMDELVKPDNKIVDYLTSFSGITKKILNPVTTKLIDVQRQLK
ALLPPNAVLVGHSLDLDLRALKMIHPYVIDTSLLYVREQGRRFKLKFLAKVILGKDIQCP
DRFGHDATEDARTALELARYFLKYGPKKIAELNLEALASHQELEAAGLEPRNTAEVVQQL
NTSVLECLDSVGQKLLFLTREADATELSSSKNCQTIKCLSNKEVLEQARVEVPLFTFSIV
QFSLEPFPPNLSEEMSKRMKIKWMEMSTVYAGPFSKNCNLRALNRLFESFGPVLSVTLTL
ESHQPHLCIQYEVLEGAQLAIESLDGSLVEGTCIKVQRPVTELTLDCDILVNELEQDSEN
RGTIYLSGVSETFKEHLLQQSSLFLGLEALILPKDLKNGKQKNYCFLRFKTFGSAHRALG
ILTGKNWKLKGRHALTPRHLHSWLRGLPPESRPPGLRVIPPPSEQEAVQMLNLDHPKIAA
WRWGRKIGKLYHSLCSGTLCLILLPGTESTHGSLSGLGLMGIKDEEESNILNCL
Download sequence
Identical sequences ENSTTRP00000015583 ENSTTRP00000015583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]