SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000015806 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000015806
Domain Number 1 Region: 264-533
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.22e-81
Family Protein kinases, catalytic subunit 0.000000000324
Further Details:      
 
Domain Number 2 Region: 151-295
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-40
Family SH2 domain 0.00000613
Further Details:      
 
Domain Number 3 Region: 80-202
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-26
Family SH3-domain 0.0000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000015806   Gene: ENSTTRG00000016672   Transcript: ENSTTRT00000016672
Sequence length 541
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_541:466003:490091:-1 gene:ENSTTRG00000016672 transcript:ENSTTRT00000016672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCIKSKENKSPAVKYRPENTPEPVSTSVSHYGAEHTAVAPTSSTKSTSVNFSNLSMTPF
GGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTVSVALYDYEARTTEDLSFKKGERFQIIN
NTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRGIF
LVRESETTKGAYSLSIRDWDEVRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTE
HADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTKV
AIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFLKE
GDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARLIE
DNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNREVL
EQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPGEN
L
Download sequence
Identical sequences ENSTTRP00000015806 ENSTTRP00000015806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]